Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NMBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NMB Polyclonal Antibody | anti-NMB antibody

NMB Antibody - N-terminal region

Reactivity
Cow, Guinea Pig, Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NMB; Polyclonal Antibody; NMB Antibody - N-terminal region; anti-NMB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KIRVHSRGNLWATGHFMGKKSLEPSSPSPLGTAPHTSLRDQRLQLSHDLL
Sequence Length
121
Applicable Applications for anti-NMB antibody
Western Blot (WB)
Homology
Cow: 86%; Guinea Pig: 86%; Human: 100%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NMB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NMBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NMBSample Type: Stomach Tumor lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NMB antibody
This is a rabbit polyclonal antibody against NMB. It was validated on Western Blot

Target Description: NMB stimulates smooth muscle contraction in a manner similar to that of bombesin.
Product Categories/Family for anti-NMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13kDa
NCBI Official Full Name
neuromedin-B isoform 1 preproprotein
NCBI Official Synonym Full Names
neuromedin B
NCBI Official Symbol
NMB
NCBI Protein Information
neuromedin-B
UniProt Protein Name
Neuromedin-B
Protein Family
UniProt Gene Name
NMB
UniProt Entry Name
NMB_HUMAN

NCBI Description

This gene encodes a member of the bombesin-like family of neuropeptides, which negatively regulate eating behavior. The encoded protein may regulate colonic smooth muscle contraction through binding to its cognate receptor, the neuromedin B receptor (NMBR). Polymorphisms of this gene may be associated with hunger, weight gain and obesity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

Uniprot Description

NMB: Stimulates smooth muscle contraction in a manner similar to that of bombesin. Belongs to the bombesin/neuromedin-B/ranatensin family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 15q22-qter

Cellular Component: neuron projection; extracellular region

Molecular Function: hormone activity; neuromedin B receptor binding

Biological Process: elevation of cytosolic calcium ion concentration; cell-cell signaling; neuropeptide signaling pathway; negative regulation of hormone secretion; positive regulation of cell proliferation; positive regulation of hormone secretion; glucose homeostasis; signal transduction; arachidonic acid secretion

Research Articles on NMB

Similar Products

Product Notes

The NMB nmb (Catalog #AAA3209535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMB Antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NMB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NMB nmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KIRVHSRGNL WATGHFMGKK SLEPSSPSPL GTAPHTSLRD QRLQLSHDLL. It is sometimes possible for the material contained within the vial of "NMB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.