Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Sample Type :Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:1000 Color/Signal Descriptions:NLRX1 Gene Name:Emilie Imbeault, UNIVERSITY OF SHERBROOKE Submitted by:)

Rabbit NLRX1 Polyclonal Antibody | anti-NLRX1 antibody

NLRX1 Antibody - N-terminal region

Gene Names
NLRX1; NOD5; NOD9; NOD26; DLNB26; CLR11.3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLRX1; Polyclonal Antibody; NLRX1 Antibody - N-terminal region; anti-NLRX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GSHLLFVLHGLEHLNLDFRLAGTGLCSDPEEPQEPAAIIVNLLRKYMLPQ
Sequence Length
921
Applicable Applications for anti-NLRX1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 86%; Rabbit: 79%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRX1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Sample Type :Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:1000 Color/Signal Descriptions:NLRX1 Gene Name:Emilie Imbeault, UNIVERSITY OF SHERBROOKE Submitted by:)

Western Blot (WB) (Sample Type :Lane 1: 35ug mouse neuroblastoma cells w/ empty vector Lane 2: 35ug mouse neuroblastoma cells w/ NLRX1 siRNA Primary Antibody Dilution :1:1000 Secondary Antibody:Anti-rabbit-HRP Secondary Antibody Dilution:1:1000 Color/Signal Descriptions:NLRX1 Gene Name:Emilie Imbeault, UNIVERSITY OF SHERBROOKE Submitted by:)
Related Product Information for anti-NLRX1 antibody
This is a rabbit polyclonal antibody against NLRX1. It was validated on Western Blot

Target Description: This gene encodes a member of the NLR family. Alternative splicing has been observed at this gene locus and two transcript variants, encoding distinct isoforms, have been identified.
Product Categories/Family for anti-NLRX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Synonym Full Names
NLR family member X1
NCBI Official Symbol
NLRX1
NCBI Official Synonym Symbols
NOD5; NOD9; NOD26; DLNB26; CLR11.3
NCBI Protein Information
NLR family member X1
UniProt Protein Name
NLR family member X1
Protein Family
UniProt Gene Name
NLRX1
UniProt Synonym Gene Names
NOD26; NOD5; NOD9; CLR11.3
UniProt Entry Name
NLRX1_HUMAN

NCBI Description

The protein encoded by this gene is a member of the NLR family and localizes to the outer mitochondrial membrane. The encoded protein is a regulator of mitochondrial antivirus responses. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2013]

Uniprot Description

NLRX1: Participates in antiviral signaling. Acts as a negative regulator of MAVS-mediated antiviral responses, through the inhibition of the virus-induced RLH (RIG-like helicase)-MAVS interaction (PubMed:18200010). Has no inhibitory function on NF- Kappa-B and type 1 interferon signaling pathways, but enhances NF- Kappa-B and JUN N-terminal kinase dependent signaling through the production of reactive oxygen species (PubMed:18219313). Interacts with MAVS. Ubiquitously expressed. Strongest expression in mammary gland, heart and muscle. Detected in HeLa, HEK293T, THP-1, HL-60, Raji, and Jurkat cell lines. Belongs to the NLRP family. 2 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 11q23.3

Cellular Component: mitochondrial outer membrane

Molecular Function: protein binding; ATP binding

Biological Process: viral reproduction; negative regulation of innate immune response; negative regulation of inflammatory response; negative regulation of interleukin-6 production; innate immune response; negative regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of interferon type I production; negative regulation of interferon-beta production

Research Articles on NLRX1

Similar Products

Product Notes

The NLRX1 nlrx1 (Catalog #AAA3216683) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRX1 Antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NLRX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NLRX1 nlrx1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GSHLLFVLHG LEHLNLDFRL AGTGLCSDPE EPQEPAAIIV NLLRKYMLPQ. It is sometimes possible for the material contained within the vial of "NLRX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.