Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NLRP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Rabbit anti-Human NLRP5 Polyclonal Antibody | anti-NLRP5 antibody

NLRP5 antibody - N-terminal region

Gene Names
NLRP5; MATER; NALP5; PAN11; PYPAF8; CLR19.8
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLRP5; Polyclonal Antibody; NLRP5 antibody - N-terminal region; anti-NLRP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LAWATSISIFENMNLRTLSEKARDDMKRHSPEDPEATMTDQGPSKEKVPG
Sequence Length
1200
Applicable Applications for anti-NLRP5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NLRP5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NLRP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-NLRP5 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-NLRP5 antibody
This is a rabbit polyclonal antibody against NLRP5. It was validated on Western Blot

Target Description: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.
Product Categories/Family for anti-NLRP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
134kDa
NCBI Official Full Name
NACHT, LRR and PYD domains-containing protein 5
NCBI Official Synonym Full Names
NLR family pyrin domain containing 5
NCBI Official Symbol
NLRP5
NCBI Official Synonym Symbols
MATER; NALP5; PAN11; PYPAF8; CLR19.8
NCBI Protein Information
NACHT, LRR and PYD domains-containing protein 5
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 5
UniProt Gene Name
NLRP5
UniProt Synonym Gene Names
MATER; NALP5
UniProt Entry Name
NALP5_HUMAN

NCBI Description

The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis. [provided by RefSeq, Jul 2008]

Uniprot Description

NLRP5: As a member of the subcortical maternal complex (SCMC), plays an essential role for zygotes to progress beyond the first embryonic cell divisions. Belongs to the NLRP family.

Protein type: Nucleolus

Chromosomal Location of Human Ortholog: 19q13.43

Cellular Component: protein complex; apical cortex; mitochondrion; nucleolus; cytosol

Molecular Function: ATP binding

Biological Process: regulation of RNA stability; organ morphogenesis; fertilization; cellular protein complex assembly; in utero embryonic development; regulation of protein stability; embryo implantation

Research Articles on NLRP5

Similar Products

Product Notes

The NLRP5 nlrp5 (Catalog #AAA3214158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP5 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NLRP5 nlrp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LAWATSISIF ENMNLRTLSE KARDDMKRHS PEDPEATMTD QGPSKEKVPG. It is sometimes possible for the material contained within the vial of "NLRP5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.