Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NLRP12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NLRP12 Polyclonal Antibody | anti-NLRP12 antibody

NLRP12 Antibody - N-terminal region

Gene Names
NLRP12; RNO; PAN6; RNO2; FCAS2; NALP12; PYPAF7; CLR19.3
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLRP12; Polyclonal Antibody; NLRP12 Antibody - N-terminal region; anti-NLRP12 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LEVSLVTPRKDPQETYRDYVRRKFRLMEDRNARLGECVNLSHRYTRLLLV
Sequence Length
1061
Applicable Applications for anti-NLRP12 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 90%; Human: 100%; Mouse: 77%; Pig: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRP12
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NLRP12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NLRP12Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NLRP12 antibody
This is a rabbit polyclonal antibody against NLRP12. It was validated on Western Blot

Target Description: This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-NLRP12 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116kDa
NCBI Official Full Name
NACHT, LRR and PYD domains-containing protein 12 isoform 2
NCBI Official Synonym Full Names
NLR family pyrin domain containing 12
NCBI Official Symbol
NLRP12
NCBI Official Synonym Symbols
RNO; PAN6; RNO2; FCAS2; NALP12; PYPAF7; CLR19.3
NCBI Protein Information
NACHT, LRR and PYD domains-containing protein 12
UniProt Protein Name
NACHT, LRR and PYD domains-containing protein 12
UniProt Gene Name
NLRP12
UniProt Synonym Gene Names
NALP12; PYPAF7; RNO
UniProt Entry Name
NAL12_HUMAN

NCBI Description

This gene encodes a member of the CATERPILLER family of cytoplasmic proteins. The encoded protein, which contains an N-terminal pyrin domain, a NACHT domain, a NACHT-associated domain, and a C-terminus leucine-rich repeat region, functions as an attenuating factor of inflammation by suppressing inflammatory responses in activated monocytes. Mutations in this gene cause familial cold autoinflammatory syndrome type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2013]

Uniprot Description

NLRP12: May mediate activation of CASP1 via ASC and promote activation of NF-kappa-B via IKK. Defects in NLRP12 are the cause of familial cold autoinflammatory syndrome type 2 (FCAS2). FCAS are rare autosomal dominant systemic inflammatory diseases characterized by episodes of rash, arthralgia, fever and conjunctivitis after generalized exposure to cold. Belongs to the NLRP family. 5 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 19q13.42

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; caspase activator activity; ATP binding

Biological Process: release of cytoplasmic sequestered NF-kappaB; caspase activation; negative regulation of cytokine secretion; negative regulation of interleukin-6 biosynthetic process; negative regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of interleukin-1 beta secretion; signal transduction; regulation of caspase activity; negative regulation of signal transduction; negative regulation of Toll signaling pathway; inhibition of NF-kappaB transcription factor; negative regulation of inflammatory response; negative regulation of protein amino acid autophosphorylation; positive regulation of MHC class I biosynthetic process; regulation of I-kappaB kinase/NF-kappaB cascade; negative regulation of interleukin-1 secretion; regulation of interleukin-18 biosynthetic process; positive regulation of inflammatory response

Disease: Familial Cold Autoinflammatory Syndrome 2

Research Articles on NLRP12

Similar Products

Product Notes

The NLRP12 nlrp12 (Catalog #AAA3216613) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRP12 Antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NLRP12 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NLRP12 nlrp12 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LEVSLVTPRK DPQETYRDYV RRKFRLMEDR NARLGECVNL SHRYTRLLLV. It is sometimes possible for the material contained within the vial of "NLRP12, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.