Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NLRC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human NLRC5 Polyclonal Antibody | anti-NLRC5 antibody

NLRC5 Antibody - N-terminal region

Gene Names
NLRC5; NOD4; NOD27; CLR16.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NLRC5; Polyclonal Antibody; NLRC5 Antibody - N-terminal region; anti-NLRC5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLLSTFGYDDGFTSQLGAEGKSQPESQLHHGLKRPHQSCGSSPRRKQCKK
Sequence Length
1356
Applicable Applications for anti-NLRC5 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NLRC5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NLRC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NLRC5Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NLRC5 antibody
This is a rabbit polyclonal antibody against NLRC5. It was validated on Western Blot

Target Description: This gene encodes a member of the caspase recruitment domain-containing NLR family. This gene plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways.
Product Categories/Family for anti-NLRC5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
149kDa
NCBI Official Full Name
protein NLRC5
NCBI Official Synonym Full Names
NLR family CARD domain containing 5
NCBI Official Symbol
NLRC5
NCBI Official Synonym Symbols
NOD4; NOD27; CLR16.1
NCBI Protein Information
protein NLRC5
UniProt Protein Name
Protein NLRC5
Protein Family
UniProt Gene Name
NLRC5
UniProt Synonym Gene Names
NOD27; NOD4; CLR16.1
UniProt Entry Name
NLRC5_HUMAN

NCBI Description

This gene encodes a member of the caspase recruitment domain-containing NLR family. This gene plays a role in cytokine response and antiviral immunity through its inhibition of NF-kappa-B activation and negative regulation of type I interferon signaling pathways. [provided by RefSeq, Oct 2011]

Uniprot Description

NLRC5: Probable regulator of the NF-kappa-B and type I interferon signaling pathways. May also regulate the type II interferon signaling pathway. Plays a role in homeostatic control of innate immunity and in antiviral defense mechanisms. Belongs to the NLRP family. 6 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 16q13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: protein binding; ATP binding

Biological Process: regulation of kinase activity; inhibition of NF-kappaB transcription factor; innate immune response; positive regulation of MHC class I biosynthetic process; positive regulation of transcription from RNA polymerase II promoter; defense response to virus; negative regulation of interferon type I production

Research Articles on NLRC5

Similar Products

Product Notes

The NLRC5 nlrc5 (Catalog #AAA3214812) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NLRC5 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NLRC5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NLRC5 nlrc5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLLSTFGYDD GFTSQLGAEG KSQPESQLHH GLKRPHQSCG SSPRRKQCKK. It is sometimes possible for the material contained within the vial of "NLRC5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.