Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using NKX2-2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Rabbit NKX2-2 Polyclonal Antibody | anti-NKX2-2 antibody

NKX2-2 Rabbit pAb

Gene Names
NKX2-2; NKX2B; NKX2.2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purification
Synonyms
NKX2-2; Polyclonal Antibody; NKX2-2 Rabbit pAb; NKX2.2; NKX2B; anti-NKX2-2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Sequence
MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKKRK
Applicable Applications for anti-NKX2-2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human NKX2-2 (NP_002500.1).
Positive Samples
mouse brain, C6, rat brain
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot analysis of extracts of various cell lines, using NKX2-2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)

Western Blot (WB) (Western blot analysis of extracts of various cell lines, using NKX2-2 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit (RM00020).Exposure time: 5min.)
Related Product Information for anti-NKX2-2 antibody
Background: The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor.
Product Categories/Family for anti-NKX2-2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30,133 Da
NCBI Official Full Name
homeobox protein Nkx-2.2
NCBI Official Synonym Full Names
NK2 homeobox 2
NCBI Official Symbol
NKX2-2
NCBI Official Synonym Symbols
NKX2B; NKX2.2
NCBI Protein Information
homeobox protein Nkx-2.2; NK-2 homolog B; homeobox protein NK-2 homolog B; NK2 transcription factor-like protein B; NK2 transcription factor related, locus 2
UniProt Protein Name
Homeobox protein Nkx-2.2
Protein Family
UniProt Gene Name
NKX2-2
UniProt Synonym Gene Names
NKX2.2; NKX2B
UniProt Entry Name
NKX22_HUMAN

NCBI Description

The protein encoded by this gene contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. [provided by RefSeq, Jul 2008]

Uniprot Description

NKX2-2: Acts as a transcriptional activator. Required for the maintenance of NEUROD1 expression in the horomone-producing endocrine cells of the pancreas. May be involved in specifying diencephalic neuromeric boundaries, and in controlling the expression of genes that play a role in axonal guidance. Associates with chromatin at the NEUROD1 promoter region. Binds to a subset of consensus elements within the NEUROD1 promoter. Belongs to the NK-2 homeobox family.

Protein type: Cell development/differentiation; Transcription factor

Chromosomal Location of Human Ortholog: 20p11.22

Cellular Component: nucleoplasm

Molecular Function: sequence-specific DNA binding; transcription coactivator activity; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: smoothened signaling pathway; transcription, DNA-dependent; spinal cord oligodendrocyte cell fate specification; spinal cord motor neuron differentiation; endocrine pancreas development; negative regulation of neuron differentiation; astrocyte differentiation; gut development; optic nerve development; response to glucose stimulus; neuron fate specification; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; brain development; positive regulation of oligodendrocyte differentiation; oligodendrocyte development; positive regulation of neuron differentiation; response to progesterone stimulus

Research Articles on NKX2-2

Similar Products

Product Notes

The NKX2-2 nkx2-2 (Catalog #AAA9142415) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NKX2-2 Rabbit pAb reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NKX2-2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NKX2-2 nkx2-2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSLTNTKTGF SVKDILDLPD TNDEEGSVAE GPEEENEGPE PAKRAGPLGQ GALDAVQSLP LKNPFYDSSD NPYTRWLAST EGLQYSLHGL AAGAPPQDSS SKSPEPSADE SPDNDKETPG GGGDAGKKRK. It is sometimes possible for the material contained within the vial of "NKX2-2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.