Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Ninjurin 1 antibody (MBS5302287) used at 1 ug/ml to detect target protein.)

Rabbit Ninjurin 1 Polyclonal Antibody | anti-NINJ1 antibody

Ninjurin 1 antibody

Gene Names
NINJ1; NIN1; NINJURIN
Applications
Western Blot
Purity
Affinity purified
Synonyms
Ninjurin 1; Polyclonal Antibody; Ninjurin 1 antibody; Polyclonal Ninjurin 1; Anti-Ninjurin 1; Ninjurin -1; NIN1; NINJ1; NINJURIN; anti-NINJ1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
Ninjurin 1 antibody was raised against the N terminal of NINJ1
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NINJ1 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
152
Applicable Applications for anti-NINJ1 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
NINJ1 is a homophilic cell adhesion molecule that promotes axonal growth. NINJ1 may play a role in nerve regeneration and in the formation and function of other tissues.
Cross-Reactivity
Human
Immunogen
Ninjurin 1 antibody was raised using the N terminal of NINJ1 corresponding to a region with amino acids DSGTEEYELNGGLPPGTPGSPDASPARWGWRHGPINVNHYASKKSAAESM
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(Ninjurin 1 antibody (MBS5302287) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (Ninjurin 1 antibody (MBS5302287) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-NINJ1 antibody
Rabbit polyclonal Ninjurin 1 antibody raised against the N terminal of NINJ1
Product Categories/Family for anti-NINJ1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
16 kDa (MW of target protein)
NCBI Official Full Name
ninjurin-1
NCBI Official Synonym Full Names
ninjurin 1
NCBI Official Symbol
NINJ1
NCBI Official Synonym Symbols
NIN1; NINJURIN
NCBI Protein Information
ninjurin-1
UniProt Protein Name
Ninjurin-1
Protein Family
UniProt Gene Name
NINJ1
UniProt Entry Name
NINJ1_HUMAN

NCBI Description

The ninjurin protein is upregulated after nerve injury both in dorsal root ganglion neurons and in Schwann cells (Araki and Milbrandt, 1996 [PubMed 8780658]). It demonstrates properties of a homophilic adhesion molecule and promotes neurite outgrowth from primary cultured dorsal root ganglion neurons.[supplied by OMIM, Aug 2009]

Uniprot Description

NINJ1: Homophilic cell adhesion molecule that promotes axonal growth. May play a role in nerve regeneration and in the formation and function of other tissues. Cell adhesion requires divalent cations. Belongs to the ninjurin family.

Protein type: Membrane protein, integral; Cell adhesion; Cell development/differentiation; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 9q22

Cellular Component: integral to membrane

Biological Process: nervous system development; tissue regeneration; cell adhesion; positive regulation of cell-matrix adhesion

Research Articles on NINJ1

Similar Products

Product Notes

The NINJ1 ninj1 (Catalog #AAA5302287) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Ninjurin 1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the NINJ1 ninj1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Ninjurin 1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.