Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human NFYC Polyclonal Antibody | anti-NFYC antibody

NFYC (Nuclear Transcription Factor Y Subunit gamma, CAAT Box DNA-binding Protein Subunit C, Nuclear Transcription Factor Y Subunit C, Transactivator HSM-1/2, DKFZp667G242, FLJ45775) (MaxLight 750)

Gene Names
NFYC; HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NFYC; Polyclonal Antibody; NFYC (Nuclear Transcription Factor Y Subunit gamma; CAAT Box DNA-binding Protein Subunit C; Nuclear Transcription Factor Y Subunit C; Transactivator HSM-1/2; DKFZp667G242; FLJ45775) (MaxLight 750); anti-NFYC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NFYC.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight750.
Applicable Applications for anti-NFYC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NFYC, aa1-335 (NP_055038.2).
Immunogen Sequence
MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAEPVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQGQAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQTEVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD
Conjugate
MaxLight750
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight750 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-NFYC antibody
This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NFYC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,302 Da
NCBI Official Full Name
nuclear transcription factor Y subunit gamma isoform 2
NCBI Official Synonym Full Names
nuclear transcription factor Y, gamma
NCBI Official Symbol
NFYC
NCBI Official Synonym Symbols
HSM; CBFC; HAP5; CBF-C; NF-YC; H1TF2A
NCBI Protein Information
nuclear transcription factor Y subunit gamma; transactivator HSM-1; transactivator HSM-1/2; CCAAT binding factor subunit C; transcription factor NF-Y, C subunit; CAAT box DNA-binding protein subunit C; nuclear transcription factor Y subunit C; CCAAT trans
UniProt Protein Name
Nuclear transcription factor Y subunit gamma
UniProt Gene Name
NFYC
UniProt Synonym Gene Names
NF-YC
UniProt Entry Name
NFYC_HUMAN

Uniprot Description

NFYC: Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters, for example in type 1 collagen, albumin and beta-actin genes. Belongs to the NFYC/HAP5 subunit family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 1p32

Cellular Component: nucleoplasm; CCAAT-binding factor complex; nucleus

Molecular Function: protein binding; DNA binding; sequence-specific DNA binding; protein heterodimerization activity; transcription coactivator activity; transcription factor activity; transcription factor binding

Biological Process: regulation of transcription from RNA polymerase II promoter; protein folding; regulation of transcription, DNA-dependent; transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; cellular lipid metabolic process

Similar Products

Product Notes

The NFYC nfyc (Catalog #AAA6387005) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFYC (Nuclear Transcription Factor Y Subunit gamma, CAAT Box DNA-binding Protein Subunit C, Nuclear Transcription Factor Y Subunit C, Transactivator HSM-1/2, DKFZp667G242, FLJ45775) (MaxLight 750) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NFYC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NFYC nfyc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NFYC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.