Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NFKBIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)

Rabbit NFKBIL1 Polyclonal Antibody | anti-NFKBIL1 antibody

NFKBIL1 antibody - N-terminal region

Gene Names
NFKBIL1; IKBL; NFKBIL
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NFKBIL1; Polyclonal Antibody; NFKBIL1 antibody - N-terminal region; anti-NFKBIL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MSNPSPQVPEEEASTSVCRPKSSMASTSRRQRRERRFRRYLSAGRLVRAQ
Sequence Length
381
Applicable Applications for anti-NFKBIL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NFKBIL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NFKBIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-NFKBIL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Stomach)
Related Product Information for anti-NFKBIL1 antibody
This is a rabbit polyclonal antibody against NFKBIL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NFKBIL1 is a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isofor
Product Categories/Family for anti-NFKBIL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
NF-kappa-B inhibitor-like protein 1 isoform 1
NCBI Official Synonym Full Names
NFKB inhibitor like 1
NCBI Official Symbol
NFKBIL1
NCBI Official Synonym Symbols
IKBL; NFKBIL
NCBI Protein Information
NF-kappa-B inhibitor-like protein 1
UniProt Protein Name
NF-kappa-B inhibitor-like protein 1
UniProt Gene Name
NFKBIL1
UniProt Synonym Gene Names
IKBL; I-kappa-B-like protein; IkappaBL

NCBI Description

This gene encodes a divergent member of the I-kappa-B family of proteins. Its function has not been determined. The gene lies within the major histocompatibility complex (MHC) class I region on chromosome 6. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2009]

Uniprot Description

NFKBIL1: Involved in the regulation of innate immune response. Acts as negative regulator of Toll-like receptor and interferon- regulatory factor (IRF) signaling pathways. Contributes to the negative regulation of transcriptional activation of NF-kappa-B target genes in response to endogenous proinflammatory stimuli. Defects in NFKBIL1 are a cause of susceptibility to rheumatoid arthritis (RA). It is a systemic inflammatory disease with autoimmune features and a complex genetic component. It primarily affects the joints and is characterized by inflammatory changes in the synovial membranes and articular structures, widespread fibrinoid degeneration of the collagen fibers in mesenchymal tissues, and by atrophy and rarefaction of bony structures. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription regulation

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: intermediate filament cytoskeleton; nucleoplasm; nucleus

Molecular Function: protein binding

Biological Process: cytoplasmic sequestering of transcription factor; I-kappaB kinase/NF-kappaB cascade; inhibition of NF-kappaB transcription factor; negative regulation of lipopolysaccharide-mediated signaling pathway; negative regulation of toll-like receptor signaling pathway; negative regulation of tumor necrosis factor production

Disease: Rheumatoid Arthritis

Research Articles on NFKBIL1

Similar Products

Product Notes

The NFKBIL1 nfkbil1 (Catalog #AAA3204135) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NFKBIL1 antibody - N-terminal region reacts with Cow, Dog, Goat, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NFKBIL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NFKBIL1 nfkbil1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MSNPSPQVPE EEASTSVCRP KSSMASTSRR QRRERRFRRY LSAGRLVRAQ. It is sometimes possible for the material contained within the vial of "NFKBIL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.