Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit NEUROD1 Polyclonal Antibody | anti-NEUROD1 antibody

NEUROD1 antibody - N-terminal region

Gene Names
NEUROD1; BETA2; BHF-1; MODY6; NEUROD; bHLHa3
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
NEUROD1; Polyclonal Antibody; NEUROD1 antibody - N-terminal region; anti-NEUROD1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLEAMNAEE
Sequence Length
356
Applicable Applications for anti-NEUROD1 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NEUROD1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-NEUROD1 Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-NEUROD1 antibody
This is a rabbit polyclonal antibody against NEUROD1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NeuroD1is a members of bHLH family that involves in neuroendocrine differentiation.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
neurogenic differentiation factor 1
NCBI Official Synonym Full Names
neuronal differentiation 1
NCBI Official Symbol
NEUROD1
NCBI Official Synonym Symbols
BETA2; BHF-1; MODY6; NEUROD; bHLHa3
NCBI Protein Information
neurogenic differentiation factor 1
UniProt Protein Name
Neurogenic differentiation factor 1
UniProt Gene Name
NEUROD1
UniProt Synonym Gene Names
BHLHA3; NEUROD; NeuroD; NeuroD1; bHLHa3
UniProt Entry Name
NDF1_HUMAN

NCBI Description

This gene encodes a member of the NeuroD family of basic helix-loop-helix (bHLH) transcription factors. The protein forms heterodimers with other bHLH proteins and activates transcription of genes that contain a specific DNA sequence known as the E-box. It regulates expression of the insulin gene, and mutations in this gene result in type II diabetes mellitus. [provided by RefSeq, Jul 2008]

Uniprot Description

NEUROD1: Acts as a transcriptional activator: mediates transcriptional activation by binding to E box-containing promoter consensus core sequences 5'-CANNTG-3'. Associates with the p300/CBP transcription coactivator complex to stimulates transcription of the secretin gene as well as the gene encoding the cyclin-dependent kinase inhibitor p21Cip1. Contributes to the regulation of several cell differentiation pathways, like those that promote the formation of early retinal ganglion cells, inner ear sensory neurons, granule cells forming either the cerebellum or the dentate gyrus cell layer of the hippocampus, endocrine islet cells of the pancreas and enteroendocrine cells of the small intestine. Together with PAX6 or SIX3, is required for the regulation of amacrine cell fate specification. Also required for dendrite morphogenesis and maintenance in the cerebellar cortex. Associates with chromatin to enhancer regulatory elements in genes encoding key transcriptional regulators of neurogenesis. Interacts (via helix-loop-helix motif domain) with EP300 (via C-terminus). Heterodimer with TCF3/E47; the heterodimer is inhibited in presence of ID2, but not NR0B2, to E- box element. Efficient DNA-binding requires dimerization with another bHLH protein. Interacts with RREB1. Interacts with EP300; the interaction is inhibited by NR0B2. Interacts with TCF3; the interaction is inhibited by ID2.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 2q32

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: protein binding; sequence-specific DNA binding; protein heterodimerization activity; double-stranded DNA binding; transcription coactivator activity; chromatin binding; transcription factor activity; transcription factor binding

Biological Process: response to drug; dentate gyrus development; transcription, DNA-dependent; positive regulation of apoptosis; positive regulation of transcription, DNA-dependent; nucleocytoplasmic transport; glucose homeostasis; endocrine pancreas development; anterior/posterior pattern formation; embryonic organ morphogenesis; neurogenesis; insulin secretion; response to glucose stimulus; cerebellum development; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription factor activity; positive regulation of neuron differentiation; positive regulation of cell differentiation; regulation of insulin secretion; negative regulation of JAK-STAT cascade; nitric oxide mediated signal transduction; inner ear development

Disease: Maturity-onset Diabetes Of The Young, Type 6; Diabetes Mellitus, Noninsulin-dependent

Research Articles on NEUROD1

Similar Products

Product Notes

The NEUROD1 neurod1 (Catalog #AAA3200720) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEUROD1 antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEUROD1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEUROD1 neurod1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTKSYSESGL MGEPQPQGPP SWTDECLSSQ DEEHEADKKE DDLEAMNAEE. It is sometimes possible for the material contained within the vial of "NEUROD1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.