Western Blot (WB)
(Neurexophilin 3 antibody (MBS5302016) used at 1 ug/ml to detect target protein.)
Rabbit Neurexophilin 3 Polyclonal Antibody | anti-NXPH3 antibody
Neurexophilin 3 antibody
Gene Names
NXPH3; NPH3
Applications
Western Blot
Purity
Affinity purified
Synonyms
Neurexophilin 3; Polyclonal Antibody; Neurexophilin 3 antibody; Polyclonal Neurexophilin 3; Anti-Neurexophilin 3; Neurexophilin -3; NPH3; NXPH3; anti-NXPH3 antibody
Host
Rabbit
Clonality
Polyclonal
Specificity
Neurexophilin 3 antibody was raised against the N terminal of NXPH3
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of NXPH3 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
252
Applicable Applications for anti-NXPH3 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
NXPH3 may be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins.
Cross-Reactivity
Human
Immunogen
Neurexophilin 3 antibody was raised using the N terminal of NXPH3 corresponding to a region with amino acids RDDHEGQPRPRVPRKRGHISPKSRPMANSTLLGLLAPPGEAWGILGQPPN
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Western Blot (WB)
(Neurexophilin 3 antibody (MBS5302016) used at 1 ug/ml to detect target protein.)
Western Blot (WB)
(Neurexophilin 3 antibody (MBS5302016) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-NXPH3 antibody
Rabbit polyclonal Neurexophilin 3 antibody raised against the N terminal of NXPH3
Product Categories/Family for anti-NXPH3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28 kDa (MW of target protein)
NCBI Official Full Name
neurexophilin-3
NCBI Official Synonym Full Names
neurexophilin 3
NCBI Official Symbol
NXPH3
NCBI Official Synonym Symbols
NPH3
NCBI Protein Information
neurexophilin-3
UniProt Protein Name
Neurexophilin-3
Protein Family
UniProt Gene Name
NXPH3
UniProt Synonym Gene Names
KIAA1159; NPH3
UniProt Entry Name
NXPH3_HUMAN
Uniprot Description
NXPH3: May be signaling molecules that resemble neuropeptides. Ligand for alpha-neurexins. Belongs to the neurexophilin family.
Protein type: Secreted, signal peptide; Secreted; Hormone
Chromosomal Location of Human Ortholog: 17q21.33
Cellular Component: extracellular region
Molecular Function: receptor binding
Biological Process: neuropeptide signaling pathway
Similar Products
Product Notes
The NXPH3 nxph3 (Catalog #AAA5302016) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's Neurexophilin 3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the NXPH3 nxph3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Neurexophilin 3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
