Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Rabbit anti-Human Neuraminidase (NEU) Polyclonal Antibody | anti-NEU antibody

Polyclonal Antibody to Neuraminidase (NEU)

Gene Names
NEU1; NEU; NANH; SIAL1
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Neuraminidase (NEU); Polyclonal Antibody; Polyclonal Antibody to Neuraminidase (NEU); anti-NEU antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against NEU. It has been selected for its ability to recognize NEU in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-AVVSDVETGV VFLFYSLCAH KAGCQVASTM LVWSKDDGVS WSTPRNLSLD IGTEVFAPGP GSGIQKQREP RKGRLIVCGH GTLERDGVFC LLSDDHGASW RYGSGVSGIP YGQPKQENDF NPDECQPYEL PDGSVVINAR NQNNYH
Sequence Length
466
Applicable Applications for anti-NEU antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant NEU (Ala141~His286) expressed in E.coli.
Cross Reactivity
Human
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2057101
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Immunohistochemistry (IHC)

(DAB staining on fromalin fixed paraffin-embedded pancreas tissue))

Immunohistochemistry (IHC) (DAB staining on fromalin fixed paraffin-embedded pancreas tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45,467 Da
NCBI Official Full Name
sialidase-1
NCBI Official Synonym Full Names
neuraminidase 1
NCBI Official Symbol
NEU1
NCBI Official Synonym Symbols
NEU; NANH; SIAL1
NCBI Protein Information
sialidase-1
UniProt Protein Name
Sialidase-1
UniProt Gene Name
NEU1
UniProt Synonym Gene Names
NANH

NCBI Description

The protein encoded by this gene is a lysosomal enzyme that cleaves terminal sialic acid residues from substrates such as glycoproteins and glycolipids. In the lysosome, this enzyme is part of a heterotrimeric complex together with beta-galactosidase and cathepsin A (the latter is also referred to as 'protective protein'). Mutations in this gene can lead to sialidosis, a lysosomal storage disease that can be type 1 (cherry red spot-myoclonus syndrome or normosomatic type), which is late-onset, or type 2 (the dysmorphic type), which occurs at an earlier age with increased severity. [provided by RefSeq, Jul 2008]

Uniprot Description

NEU1: Catalyzes the removal of sialic acid (N-acetylneuramic acid) moities from glycoproteins and glycolipids. To be active, it is strictly dependent on its presence in the multienzyme complex. Appears to have a preference for alpha 2-3 and alpha 2-6 sialyl linkage. Defects in NEU1 are the cause of sialidosis (SIALIDOSIS). It is a lysosomal storage disease occurring as two types with various manifestations. Type 1 sialidosis (cherry red spot-myoclonus syndrome or normosomatic type) is late-onset and it is characterized by the formation of cherry red macular spots in childhood, progressive debilitating myoclonus, insiduous visual loss and rarely ataxia. The diagnosis can be confirmed by the screening of the urine for sialyloligosaccharides. Type 2 sialidosis (also known as dysmorphic type) occurs as several variants of increasing severity with earlier age of onset. It is characterized by the presence of abnormal somatic features including coarse facies and dysostosis multiplex, vertebral deformities, mental retardation, cherry-red spot/myoclonus, sialuria, cytoplasmic vacuolation of peripheral lymphocytes, bone marrow cells and conjunctival epithelial cells. Belongs to the glycosyl hydrolase 33 family.

Protein type: EC 3.2.1.18; Glycan Metabolism - other glycan degradation; Hydrolase; Lipid Metabolism - sphingolipid; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 6p21.33

Cellular Component: cell junction; extracellular exosome; extracellular region; intracellular membrane-bound organelle; lysosomal lumen; lysosomal membrane; lysosome; membrane; plasma membrane

Molecular Function: alpha-sialidase activity; exo-alpha-sialidase activity; protein binding

Biological Process: ganglioside catabolic process; glycosphingolipid metabolic process; neutrophil degranulation; oligosaccharide catabolic process

Disease: Neuraminidase Deficiency

Research Articles on NEU

Similar Products

Product Notes

The NEU neu1 (Catalog #AAA2004027) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Neuraminidase (NEU) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Neuraminidase (NEU) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the NEU neu1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-AVVSDVE TGV VFLFYSLCAH KAGCQVASTM LVWSKDDGVS WSTPRNLSLD IGTEVFAPGP GSGIQKQREP RKGRLIVCGH GTLERDGVFC LLSDDHGASW RYGSGVSGIP YGQPKQENDF NPDECQPYEL PDGSVVINAR NQNNYH. It is sometimes possible for the material contained within the vial of "Neuraminidase (NEU), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.