Rabbit anti-Human NETO2 Polyclonal Antibody | anti-NETO2 antibody

NETO2 (BTCL2, Neuropilin and Tolloid-like Protein 2, Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2, FLJ10430, FLJ14724, FLJ90456, NEOT2)

Cat. Num. AAA645214

• Gene Names: NETO2; BTCL2; NEOT2
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NETO2; Polyclonal Antibody; NETO2 (BTCL2; Neuropilin and Tolloid-like Protein 2; Brain-specific Transmembrane Protein Containing 2 CUB and 1 LDL-receptor Class A Domains Protein 2; FLJ10430; FLJ14724; FLJ90456; NEOT2); Anti -NETO2 (BTCL2; anti-NETO2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NETO2.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELDNYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHECPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF

• Applicable Applications for anti-NETO2 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human NETO2, aa1-148 (AAH12381.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NETO2 rabbit polyclonal antibody. Western Blot analysis of NETO2 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of NETO2 expression in transfected 293T cell line by NETO2 polyclonal antibody. Lane 1: NETO2 transfected lysate (17kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NETO2 antibody

This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. It also has an intracellular FXNPXY-like motif, which has been shown in other proteins to be essential for the internalization of clathrin coated pits during endocytosis. Alternatively spliced transcript variants have been observed, but they have not been fully characterized. [provided by RefSeq].

Product Categories/Family for anti-NETO2 antibody

Antibodies; Abs to Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 319996652
• NCBI GeneID: 81831
• NCBI Accession #: NP_001188406.1
• NCBI GenBank Nucleotide #: NM_001201477.1
• UniProt Accession #: Q8NC67; Q7Z381; Q8ND51; Q96SP4; Q9NVY8
• Molecular Weight: 59,393 Da
• NCBI Official Full Name: neuropilin and tolloid-like protein 2 isoform 2
• NCBI Official Synonym Full Names: neuropilin (NRP) and tolloid (TLL)-like 2
• NCBI Official Symbol: NETO2
• NCBI Official Synonym Symbols: BTCL2; NEOT2
• NCBI Protein Information: neuropilin and tolloid-like protein 2; brain-specific transmembrane protein containing 2 CUB and 1 LDL-receptor class A domains protein 2
• UniProt Protein Name: Neuropilin and tolloid-like protein 2
• Protein Family: Neuropilin and tolloid-like protein
• UniProt Gene Name: NETO2
• UniProt Synonym Gene Names: BTCL2
• UniProt Entry Name: NETO2_HUMAN

NCBI Description

This gene encodes a predicted transmembrane protein containing two extracellular CUB domains followed by a low-density lipoprotein class A (LDLa) domain. A similar gene in rats encodes a protein that modulates glutamate signaling in the brain by regulating kainate receptor function. Expression of this gene may be a biomarker for proliferating infantile hemangiomas. A pseudogene of this gene is located on the long arm of chromosome 8. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jan 2011]

Uniprot Description

NETO2: Accessory subunit of neuronal kainate-sensitive glutamate receptors, GRIK2 and GRIK3. Increases kainate-receptor channel activity, slowing the decay kinetics of the receptors, without affecting their expression at the cell surface, and increasing the open probability of the receptor channels. Modulates the agonist sensitivity of kainate receptors. Slows the decay of kainate receptor-mediated excitatory postsynaptic currents (EPSCs), thus directly influencing synaptic transmission. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 16q11

Cellular Component: kainate selective glutamate receptor complex; postsynaptic density

Molecular Function: ionotropic glutamate receptor binding