Rabbit anti-Mouse NECAP2 Polyclonal Antibody | anti-NECAP2 antibody
NECAP2 Polyclonal Antibody
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NECAP2; Polyclonal Antibody; NECAP2 Polyclonal Antibody; anti-NECAP2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
GKTSTLIPPPGEQLAVGGSLVQPAVAPSSGGAPVPWPQPNPATADIWGDFTKSTGSTSSQTQPGTGWVQF
Sequence Length
273
Applicable Applications for anti-NECAP2 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human NECAP2
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Cytoplasmic vesicle, clathrin-coated vesicle membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-NECAP2 antibody
This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-NECAP2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
19kDa/25kDa/28kDa/29kDa
NCBI Official Full Name
adaptin ear-binding coat-associated protein 2 isoform 2
NCBI Official Synonym Full Names
NECAP endocytosis associated 2
NCBI Official Symbol
NECAP2
NCBI Protein Information
adaptin ear-binding coat-associated protein 2
UniProt Protein Name
Adaptin ear-binding coat-associated protein 2
Protein Family
UniProt Gene Name
NECAP2
UniProt Synonym Gene Names
NECAP-2
NCBI Description
This gene likely encodes a member of the adaptin-ear-binding coat-associated protein family. Studies of a similar protein in rat suggest a role in clathrin-mediated endocytosis. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]
Uniprot Description
Involved in endocytosis.
Research Articles on NECAP2
Similar Products
Product Notes
The NECAP2 necap2 (Catalog #AAA9134351) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NECAP2 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NECAP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the NECAP2 necap2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKTSTLIPPP GEQLAVGGSL VQPAVAPSSG GAPVPWPQPN PATADIWGDF TKSTGSTSSQ TQPGTGWVQF. It is sometimes possible for the material contained within the vial of "NECAP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
