Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (NDUFB6 rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.)

Rabbit anti-Human, Mouse NDUFB6 Polyclonal Antibody | anti-NDUFB6 antibody

NDUFB6 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 6, Complex I-B17, CI-B17, NADH-ubiquinone Oxidoreductase B17 Subunit, MGC13675)

Gene Names
NDUFB6; CI; B17
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDUFB6; Polyclonal Antibody; NDUFB6 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 6; Complex I-B17; CI-B17; NADH-ubiquinone Oxidoreductase B17 Subunit; MGC13675); Anti -NDUFB6 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 6; anti-NDUFB6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFB6. Species Crossreactivity: mouse.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIFVFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH
Applicable Applications for anti-NDUFB6 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NDUFB6, aa1-128 (NP_002484.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NDUFB6 rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.)

Western Blot (WB) (NDUFB6 rabbit polyclonal antibody. Western Blot analysis of NDUFB6 expression in mouse kidney.)

Western Blot (WB)

(Western Blot analysis of NDUFB6 expression in transfected 293T cell line by NDUFB6 polyclonal antibody. Lane 1: NDUFB6 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFB6 expression in transfected 293T cell line by NDUFB6 polyclonal antibody. Lane 1: NDUFB6 transfected lysate (15.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDUFB6 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFB6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15,489 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 6, 17kDa
NCBI Official Symbol
NDUFB6
NCBI Official Synonym Symbols
CI; B17
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6; CI-B17; complex I-B17; NADH-ubiquinone oxidoreductase B17 subunit; NADH-ubiquinone oxidoreductase beta subunit, 6; complex I, mitochondrial respiratory chain, B17 subunit
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
Protein Family
UniProt Gene Name
NDUFB6
UniProt Synonym Gene Names
CI-B17
UniProt Entry Name
NDUB6_HUMAN

NCBI Description

The protein encoded by this gene is a subunit of the multisubunit NADH:ubiquinone oxidoreductase (complex I). Mammalian complex I is composed of 45 different subunits. It locates at the mitochondrial inner membrane. This protein has NADH dehydrogenase activity and oxidoreductase activity. It transfers electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Alternative splicing occurs at this locus and three transcript variants encoding distinct isoforms have been identified. [provided by RefSeq, Jan 2011]

Uniprot Description

NDUFB6: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB6 subunit family.

Protein type: EC 1.6.5.3; Membrane protein, integral; Oxidoreductase; EC 1.6.99.3; Energy Metabolism - oxidative phosphorylation; Mitochondrial

Chromosomal Location of Human Ortholog: 9p21.1

Cellular Component: nucleoplasm; mitochondrion; mitochondrial membrane; mitochondrial inner membrane; integral to membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFB6

Similar Products

Product Notes

The NDUFB6 ndufb6 (Catalog #AAA6002409) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFB6 (NADH Dehydrogenase [Ubiquinone] 1 beta Subcomplex Subunit 6, Complex I-B17, CI-B17, NADH-ubiquinone Oxidoreductase B17 Subunit, MGC13675) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NDUFB6 ndufb6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MTGYTPDEKL RLQQLRELRR RWLKDQELSP REPVLPPQKM GPMEKFWNKF LENKSPWRKM VHGVYKKSIF VFTHVLVPVW IIHYYMKYHV SEKPYGIVEK KSRIFPGDTI LETGEVIPPM KEFPDQHH. It is sometimes possible for the material contained within the vial of "NDUFB6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.