Western Blot (WB)
(WB Suggested Anti-NDUFB10 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Rabbit NDUFB10 Polyclonal Antibody | anti-NDUFB10 antibody
NDUFB10 Antibody - C-terminal region
Gene Names
NDUFB10; PDSW
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NDUFB10; Polyclonal Antibody; NDUFB10 Antibody - C-terminal region; anti-NDUFB10 antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KVDQEIINIMQDRLKACQQREGQNYQQNCIKEVEQFTQVAKAYQDRYQDL
Sequence Length
172
Applicable Applications for anti-NDUFB10 antibody
Western Blot (WB)
Homology
Dog: 79%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rat: 93%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of NDUFB10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NDUFB10 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Western Blot (WB)
(WB Suggested Anti-NDUFB10 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal kidney)
Related Product Information for anti-NDUFB10 antibody
This is a rabbit polyclonal antibody against NDUFB10. It was validated on Western Blot
Target Description: NDUFB10 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Target Description: NDUFB10 is an accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFB10 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit B10
NCBI Official Symbol
NDUFB10
NCBI Official Synonym Symbols
PDSW
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
UniProt Gene Name
NDUFB10
UniProt Synonym Gene Names
CI-PDSW
UniProt Entry Name
NDUBA_HUMAN
Uniprot Description
NDUFB10: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFB10 subunit family.
Protein type: EC 1.6.5.3; Oxidoreductase; EC 1.6.99.3; Mitochondrial; Energy Metabolism - oxidative phosphorylation
Chromosomal Location of Human Ortholog: 16p13.3
Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex I
Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity
Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone
Research Articles on NDUFB10
Similar Products
Product Notes
The NDUFB10 ndufb10 (Catalog #AAA3215782) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFB10 Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFB10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFB10 ndufb10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KVDQEIINIM QDRLKACQQR EGQNYQQNCI KEVEQFTQVA KAYQDRYQDL. It is sometimes possible for the material contained within the vial of "NDUFB10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
