Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NDUFAF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit NDUFAF2 Polyclonal Antibody | anti-NDUFAF2 antibody

NDUFAF2 Antibody - N-terminal region

Gene Names
NDUFAF2; MMTN; B17.2L; MC1DN10; mimitin; NDUFA12L
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NDUFAF2; Polyclonal Antibody; NDUFAF2 Antibody - N-terminal region; anti-NDUFAF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTEW
Sequence Length
169
Applicable Applications for anti-NDUFAF2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 93%; Rabbit: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NDUFAF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NDUFAF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-NDUFAF2 AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-NDUFAF2 antibody
This is a rabbit polyclonal antibody against NDUFAF2. It was validated on Western Blot

Target Description: NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency.
Product Categories/Family for anti-NDUFAF2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase complex assembly factor 2
NCBI Official Symbol
NDUFAF2
NCBI Official Synonym Symbols
MMTN; B17.2L; MC1DN10; mimitin; NDUFA12L
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2
UniProt Protein Name
Mimitin, mitochondrial
Protein Family
UniProt Gene Name
NDUFAF2
UniProt Synonym Gene Names
NDUFA12L; B17.2L; MMTN
UniProt Entry Name
MIMIT_HUMAN

NCBI Description

NADH:ubiquinone oxidoreductase (complex I) catalyzes the transfer of electrons from NADH to ubiquinone (coenzyme Q) in the first step of the mitochondrial respiratory chain, resulting in the translocation of protons across the inner mitochondrial membrane. This gene encodes a complex I assembly factor. Mutations in this gene cause progressive encephalopathy resulting from mitochondrial complex I deficiency. [provided by RefSeq, Jul 2008]

Uniprot Description

NDUFAF2: Acts as a molecular chaperone for mitochondrial complex I assembly. Defects in NDUFAF2 are a cause of mitochondrial complex I deficiency (MT-C1D). A disorder of the mitochondrial respiratory chain that causes a wide range of clinical disorders, from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. Belongs to the complex I NDUFA12 subunit family.

Chromosomal Location of Human Ortholog: 5q12.1

Cellular Component: mitochondrion

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Disease: Leigh Syndrome; Mitochondrial Complex I Deficiency

Research Articles on NDUFAF2

Similar Products

Product Notes

The NDUFAF2 ndufaf2 (Catalog #AAA3216957) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFAF2 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFAF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDUFAF2 ndufaf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HVGTDQFGNK YYYIPQYKNW RGQTIREKRI VEAANKKEVD YEAGDIPTEW. It is sometimes possible for the material contained within the vial of "NDUFAF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.