Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NDEL1Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NDEL1 Polyclonal Antibody | anti-NDEL1 antibody

NDEL1 Antibody - C-terminal region

Gene Names
NDEL1; EOPA; NDE2; NUDEL; MITAP1; NDE1L1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NDEL1; Polyclonal Antibody; NDEL1 Antibody - C-terminal region; anti-NDEL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: VLNGNGTKFSRSGHTSFFDKGAVNGFDPAPPPPGLGSSRPSSAPGMLPLS
Sequence Length
345
Applicable Applications for anti-NDEL1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C region of human NDEL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NDEL1Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NDEL1Sample Tissue: ACHN Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NDEL1 antibody
This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38 kDa
NCBI Official Full Name
nuclear distribution protein nudE-like 1 isoform A
NCBI Official Synonym Full Names
nudE neurodevelopment protein 1 like 1
NCBI Official Symbol
NDEL1
NCBI Official Synonym Symbols
EOPA; NDE2; NUDEL; MITAP1; NDE1L1
NCBI Protein Information
nuclear distribution protein nudE-like 1
UniProt Protein Name
Nuclear distribution protein nudE-like 1
UniProt Gene Name
NDEL1
UniProt Synonym Gene Names
EOPA; MITAP1; NUDEL; Protein Nudel
UniProt Entry Name
NDEL1_HUMAN

NCBI Description

This gene encodes a coiled-coil protein that plays a role in multiple processes including cytoskeletal organization, cell signaling and neuron migration, outgrowth and maintenance. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the long arm of chromosome X. [provided by RefSeq, Mar 2012]

Uniprot Description

NDEL1: Required for organization of the cellular microtubule array and microtubule anchoring at the centrosome. May regulate microtubule organization at least in part by targeting the microtubule severing protein KATNA1 to the centrosome. Also positively regulates the activity of the minus-end directed microtubule motor protein dynein. May enhance dynein-mediated microtubule sliding by targeting dynein to the microtubule plus ends. Required for several dynein- and microtubule-dependent processes such as the maintenance of Golgi integrity, the centripetal motion of secretory vesicles and the coupling of the nucleus and centrosome. Also required during brain development for the migration of newly formed neurons from the ventricular/subventricular zone toward the cortical plate. Plays a role, together with DISC1, in the regulation of neurite outgrowth. Required for mitosis in some cell types but appears to be dispensible for mitosis in cortical neuronal progenitors, which instead requires NDE1. Facilitates the polymerization of neurofilaments from the individual subunits NEFH and NEFL. Belongs to the nudE family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Microtubule-binding

Chromosomal Location of Human Ortholog: 17p13.1

Cellular Component: axon hillock; kinetochore; microtubule; kinesin complex; centrosome; neurofilament cytoskeleton; cytoplasm; leading edge; nucleolus; nuclear envelope; spindle; cytosol

Molecular Function: protein binding; microtubule binding; beta-tubulin binding; alpha-tubulin binding

Biological Process: cell migration; positive regulation of axon regeneration; central nervous system neuron axonogenesis; positive regulation of axon extension; establishment of chromosome localization; neuron migration; nuclear envelope disassembly; proteolysis; microtubule nucleation; inner cell mass cell proliferation; retrograde axon cargo transport; chromosome segregation; mitotic centrosome separation; establishment of mitotic spindle orientation; centrosome localization; neurofilament cytoskeleton organization and biogenesis; vesicle transport along microtubule; cerebral cortex radially oriented cell migration; mitotic cell cycle

Research Articles on NDEL1

Similar Products

Product Notes

The NDEL1 ndel1 (Catalog #AAA3220798) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDEL1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDEL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDEL1 ndel1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLNGNGTKFS RSGHTSFFDK GAVNGFDPAP PPPGLGSSRP SSAPGMLPLS. It is sometimes possible for the material contained within the vial of "NDEL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.