Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ND6Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Rabbit anti-Human, Pig ND6 Polyclonal Antibody | anti-ND6 antibody

ND6 Antibody

Gene Names
MT-ND6; MTND6; ND6
Reactivity
Human, Pig
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ND6; Polyclonal Antibody; ND6 Antibody; anti-ND6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Pig
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DGVVVVVNFNSVGSWMIYEGEGSGLIREDPIGAGALYDYGRWLVVVTGWT
Sequence Length
174
Applicable Applications for anti-ND6 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ND6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ND6Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ND6Sample Tissue: Human HT1080 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: ND6Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ND6Sample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-ND6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-ND6 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-ND6 antibody
This is a rabbit polyclonal antibody against ND6. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The exact function of ND6 remains unknown.
Product Categories/Family for anti-ND6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19kDa
NCBI Official Synonym Full Names
mitochondrially encoded NADH dehydrogenase 6
NCBI Official Symbol
MT-ND6
NCBI Official Synonym Symbols
MTND6; ND6
NCBI Protein Information
NADH dehydrogenase, subunit 6 (complex I)
UniProt Protein Name
NADH-ubiquinone oxidoreductase chain 6
UniProt Gene Name
MT-ND6
UniProt Synonym Gene Names
MTND6; NADH6; ND6
UniProt Entry Name
NU6M_HUMAN

Uniprot Description

MT-ND6: Core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assembly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Defects in MT-ND6 are a cause of Leber hereditary optic neuropathy (LHON). LHON is a maternally inherited disease resulting in acute or subacute loss of central vision, due to optic nerve dysfunction. Cardiac conduction defects and neurological defects have also been described in some patients. LHON results from primary mitochondrial DNA mutations affecting the respiratory chain complexes. Defects in MT-ND6 are a cause of Leber hereditary optic neuropathy with dystonia (LDYT); also called familial dystonia with visual failure and striatal lucencies. LDYT is part of a spectrum of Leber hereditary optic neuropathy. It is characterized by the association of optic atrophy and central vision loss with dystonia. Defects in MT-ND6 are a cause of mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes syndrome (MELAS). MELAS is a genetically heterogenious disorder, characterized by episodic vomiting, seizures, and recurrent cerebral insults resembling strokes and causing hemiparesis, hemianopsia, or cortical blindness. Defects in MT-ND6 are a cause of mitochondrial complex I deficiency (MT-C1D). A disorder of the mitochondrial respiratory chain that causes a wide range of clinical manifestations from lethal neonatal disease to adult-onset neurodegenerative disorders. Phenotypes include macrocephaly with progressive leukodystrophy, non-specific encephalopathy, cardiomyopathy, myopathy, liver disease, Leigh syndrome, Leber hereditary optic neuropathy, and some forms of Parkinson disease. Belongs to the complex I subunit 6 family.

Protein type: Membrane protein, multi-pass; EC 1.6.5.3; Oxidoreductase; Membrane protein, integral; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: -

Disease: Mitochondrial Myopathy, Encephalopathy, Lactic Acidosis, And Stroke-like Episodes; Leber Optic Atrophy

Research Articles on ND6

Similar Products

Product Notes

The ND6 mt-nd6 (Catalog #AAA3209862) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ND6 Antibody reacts with Human, Pig and may cross-react with other species as described in the data sheet. AAA Biotech's ND6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ND6 mt-nd6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGVVVVVNFN SVGSWMIYEG EGSGLIREDP IGAGALYDYG RWLVVVTGWT. It is sometimes possible for the material contained within the vial of "ND6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.