Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NCK1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NCK1 Polyclonal Antibody | anti-NCK1 antibody

NCK1 Antibody - N-terminal region

Gene Names
NCK1; NCK; nck-1; NCKalpha
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NCK1; Polyclonal Antibody; NCK1 Antibody - N-terminal region; anti-NCK1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGI
Sequence Length
377
Applicable Applications for anti-NCK1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NCK1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NCK1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NCK1Sample Tissue: Human U937 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NCK1 antibody
The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found.
Product Categories/Family for anti-NCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43 kDa
NCBI Official Full Name
cytoplasmic protein NCK1 isoform 2
NCBI Official Synonym Full Names
NCK adaptor protein 1
NCBI Official Symbol
NCK1
NCBI Official Synonym Symbols
NCK; nck-1; NCKalpha
NCBI Protein Information
cytoplasmic protein NCK1
UniProt Protein Name
Cytoplasmic protein NCK1
Protein Family
UniProt Gene Name
NCK1
UniProt Synonym Gene Names
NCK; Nck-1
UniProt Entry Name
NCK1_HUMAN

NCBI Description

The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Jun 2010]

Uniprot Description

NCK1: adapter protein containing Src homology 2 and 3 (SH2 and SH3) domains. Transduces signals from tyrosine-phosphorylated growth factor receptors to their cellular substrates.

Protein type: Adaptor/scaffold; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: endoplasmic reticulum; cytoplasm; plasma membrane; ribosome; protein phosphatase type 1 complex; intercellular junction; vesicle membrane; cytosol; nucleus

Molecular Function: protein binding, bridging; protein domain specific binding; protein binding; receptor signaling complex scaffold activity; protein kinase inhibitor activity; SH3/SH2 adaptor activity; cytoskeletal adaptor activity; receptor tyrosine kinase binding; receptor binding

Biological Process: lamellipodium biogenesis; axon guidance; positive regulation of translation in response to stress; T cell activation; negative regulation of peptidyl-serine phosphorylation; signal complex assembly; actin filament organization; response to other organism; T cell receptor signaling pathway; substrate-bound cell migration, cell extension; positive regulation of actin filament polymerization; negative regulation of protein kinase activity; innate immune response; positive regulation of transcription from RNA polymerase II promoter; positive regulation of T cell proliferation; vascular endothelial growth factor receptor signaling pathway

Research Articles on NCK1

Similar Products

Product Notes

The NCK1 nck1 (Catalog #AAA3223481) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCK1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCK1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCK1 nck1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RLWLLDDSKS WWRVRNSMNK TGFVPSNYVE RKNSARKASI VKNLKDTLGI. It is sometimes possible for the material contained within the vial of "NCK1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.