Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NCEH1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit NCEH1 Polyclonal Antibody | anti-NCEH1 antibody

NCEH1 Antibody - C-terminal region

Gene Names
NCEH1; NCEH; AADACL1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
NCEH1; Polyclonal Antibody; NCEH1 Antibody - C-terminal region; anti-NCEH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GIMYAKRLESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKW
Sequence Length
275
Applicable Applications for anti-NCEH1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human NCEH1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NCEH1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NCEH1Sample Type: THP-1 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NCEH1 antibody
This is a rabbit polyclonal antibody against NCEH1. It was validated on Western Blot

Target Description: NCEH1 hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor. It may be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. NCEH1 also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. It may contribute to cancer pathogenesis by promoting tumor cell migration.
Product Categories/Family for anti-NCEH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
neutral cholesterol ester hydrolase 1 isoform a
NCBI Official Synonym Full Names
neutral cholesterol ester hydrolase 1
NCBI Official Symbol
NCEH1
NCBI Official Synonym Symbols
NCEH; AADACL1
NCBI Protein Information
neutral cholesterol ester hydrolase 1
UniProt Protein Name
Neutral cholesterol ester hydrolase 1
UniProt Gene Name
NCEH1
UniProt Synonym Gene Names
AADACL1; KIAA1363; NCEH
UniProt Entry Name
NCEH1_HUMAN

Uniprot Description

AADACL1: a single-pass type II membrane microsomal protein. Hydrolyzes 2-acetyl monoalkylglycerol ether, the penultimate precursor of the pathway for de novo synthesis of platelet-activating factor (acetyl-glyceryl-ether-phosphorylcholine). Elevated in invasive cancer cells from several different tumor types. May be involved in the elevated neutral ether lipid content and elevated LPA signaling in cancer cells. May be responsible for cholesterol ester hydrolysis in macrophages, thereby contributing to the development of atherosclerosis. Also involved in organ detoxification by hydrolyzing exogenous organophosphorus compounds. May contribute to cancer pathogenesis by promoting tumor cell migration. A key enzymatic node regulating an ether lipid signaling network in cancer; regulates MAGE and lysophospholipid levels in invasive cancer cells. Three alternatively spliced human isoforms have been described.

Protein type: Hydrolase; EC 3.1.1.-; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q26.31

Cellular Component: membrane; endoplasmic reticulum; integral to membrane

Biological Process: lipid catabolic process

Research Articles on NCEH1

Similar Products

Product Notes

The NCEH1 nceh1 (Catalog #AAA3209521) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCEH1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NCEH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCEH1 nceh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GIMYAKRLES AGVEVTLDHF EDGFHGCMIF TSWPTNFSVG IRTRNSYIKW. It is sometimes possible for the material contained within the vial of "NCEH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.