Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NCAPHSample Type: Human JurkatAntibody Dilution: 1.0ug/mlNCAPH is supported by BioGPS gene expression data to be expressed in Jurkat)

Rabbit NCAPH Polyclonal Antibody | anti-NCAPH antibody

NCAPH antibody - N-terminal region

Gene Names
NCAPH; CAPH; BRRN1; CAP-H; MCPH23
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NCAPH; Polyclonal Antibody; NCAPH antibody - N-terminal region; anti-NCAPH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MPLPRKAPLNIPGTPVLEDFPQNDDEKERLQRRRSRVFDLQFSTDSPRLL
Sequence Length
741
Applicable Applications for anti-NCAPH antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NCAPH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NCAPHSample Type: Human JurkatAntibody Dilution: 1.0ug/mlNCAPH is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB) (Host: RabbitTarget Name: NCAPHSample Type: Human JurkatAntibody Dilution: 1.0ug/mlNCAPH is supported by BioGPS gene expression data to be expressed in Jurkat)

Western Blot (WB)

(Host: RabbitTarget Name: NCAPHSample Type: Human MCF7Antibody Dilution: 1.0ug/mlNCAPH is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB) (Host: RabbitTarget Name: NCAPHSample Type: Human MCF7Antibody Dilution: 1.0ug/mlNCAPH is supported by BioGPS gene expression data to be expressed in MCF7)

Western Blot (WB)

(WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateNCAPH is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-NCAPH Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HepG2 cell lysateNCAPH is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-NCAPH antibody
This is a rabbit polyclonal antibody against NCAPH. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NCAPH is a member of the barr family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization.
Product Categories/Family for anti-NCAPH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82kDa
NCBI Official Full Name
condensin complex subunit 2 isoform 1
NCBI Official Synonym Full Names
non-SMC condensin I complex subunit H
NCBI Official Symbol
NCAPH
NCBI Official Synonym Symbols
CAPH; BRRN1; CAP-H; MCPH23
NCBI Protein Information
condensin complex subunit 2
UniProt Protein Name
Condensin complex subunit 2
Protein Family
UniProt Gene Name
NCAPH
UniProt Synonym Gene Names
BRRN; BRRN1; CAPH; KIAA0074; hCAP-H
UniProt Entry Name
CND2_HUMAN

NCBI Description

This gene encodes a member of the barr gene family and a regulatory subunit of the condensin complex. This complex is required for the conversion of interphase chromatin into condensed chromosomes. The protein encoded by this gene is associated with mitotic chromosomes, except during the early phase of chromosome condensation. During interphase, the protein has a distinct punctate nucleolar localization. Alternatively spliced transcript variants encoding different proteins have been described. [provided by RefSeq, Jul 2013]

Uniprot Description

NCAPH: Regulatory subunit of the condensin complex, a complex required for conversion of interphase chromatin into mitotic-like condense chromosomes. The condensin complex probably introduces positive supercoils into relaxed DNA in the presence of type I topoisomerases and converts nicked DNA into positive knotted forms in the presence of type II topoisomerases. Belongs to the CND2 (condensin subunit 2) family.

Protein type: Cell cycle regulation

Chromosomal Location of Human Ortholog: 2q11.2

Cellular Component: membrane; cytoplasm; condensin complex; nucleus; cytosol

Molecular Function: protein binding

Biological Process: mitotic chromosome condensation; cell division; mitotic cell cycle

Research Articles on NCAPH

Similar Products

Product Notes

The NCAPH ncaph (Catalog #AAA3208119) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCAPH antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NCAPH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCAPH ncaph for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MPLPRKAPLN IPGTPVLEDF PQNDDEKERL QRRRSRVFDL QFSTDSPRLL. It is sometimes possible for the material contained within the vial of "NCAPH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.