Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NCAM2 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)

Rabbit NCAM2 Polyclonal Antibody | anti-NCAM2 antibody

NCAM2 antibody - middle region

Gene Names
NCAM2; NCAM21
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NCAM2; Polyclonal Antibody; NCAM2 antibody - middle region; anti-NCAM2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KGQGDYSKIEIFQTLPVREPSPPSIHGQPSSGKSFKLSITKQDDGGAPIL
Sequence Length
837
Applicable Applications for anti-NCAM2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NCAM2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NCAM2 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)

Western Blot (WB) (WB Suggested Anti-NCAM2 Antibody Titration: 0.2-1 ug/mlPositive Control: ACHN cell lysate)
Related Product Information for anti-NCAM2 antibody
This is a rabbit polyclonal antibody against NCAM2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons.
Product Categories/Family for anti-NCAM2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
neural cell adhesion molecule 2 isoform 2
NCBI Official Synonym Full Names
neural cell adhesion molecule 2
NCBI Official Symbol
NCAM2
NCBI Official Synonym Symbols
NCAM21
NCBI Protein Information
neural cell adhesion molecule 2
UniProt Protein Name
Neural cell adhesion molecule 2
UniProt Gene Name
NCAM2
UniProt Synonym Gene Names
NCAM21; N-CAM-2; NCAM-2
UniProt Entry Name
NCAM2_HUMAN

NCBI Description

The protein encoded by this gene belongs to the immunoglobulin superfamily. It is a type I membrane protein and may function in selective fasciculation and zone-to-zone projection of the primary olfactory axons. [provided by RefSeq, Jul 2008]

Uniprot Description

NCAM2: May play important roles in selective fasciculation and zone-to-zone projection of the primary olfactory axons.

Protein type: Cell adhesion; Motility/polarity/chemotaxis; Membrane protein, integral

Chromosomal Location of Human Ortholog: 21q21.1

Cellular Component: axon; integral to membrane; plasma membrane

Biological Process: sensory perception of smell; axonal fasciculation; neuron adhesion

Research Articles on NCAM2

Similar Products

Product Notes

The NCAM2 ncam2 (Catalog #AAA3208225) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NCAM2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NCAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NCAM2 ncam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGQGDYSKIE IFQTLPVREP SPPSIHGQPS SGKSFKLSIT KQDDGGAPIL. It is sometimes possible for the material contained within the vial of "NCAM2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.