Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-NAXE Polyclonal Antibody)

Rabbit NAXE Polyclonal Antibody | anti-NAXE antibody

NAXE Polyclonal Antibody

Gene Names
NAXE; AIBP; PEBEL; YJEFN1; APOA1BP
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
NAXE; Polyclonal Antibody; NAXE Polyclonal Antibody; AIBP; APOA1BP; PEBEL; YJEFN1; NAD(P)HX epimerase; anti-NAXE antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
1.3 mg/ml (varies by lot)
Sequence Length
288
Applicable Applications for anti-NAXE antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 48-170 of human NAXE (NP_658985.2).
Immunogen Sequence
DSEVMASTVVKYLSQEEAQAVDQELFNEYQFSVDQLMELAGLSCATAIAKAYPPTSMSRSPPTVLVICGPGNNGGDGLVCARHLKLFGYEPTIYYPKRPNKPLFTALVTQCQKMDIPFLGEMP
Positive Samples
293T, LO2, NIH/3T3, Rat Lung
Cellular Location
Mitochondrion, Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-NAXE Polyclonal Antibody)

Western Blot (WB) (Western blot-NAXE Polyclonal Antibody)
Related Product Information for anti-NAXE antibody
The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 20kDa; 31kDa
Observed: 32kDa
NCBI Official Full Name
NAD(P)H-hydrate epimerase
NCBI Official Synonym Full Names
NAD(P)HX epimerase
NCBI Official Symbol
NAXE
NCBI Official Synonym Symbols
AIBP; PEBEL; YJEFN1; APOA1BP
NCBI Protein Information
NAD(P)H-hydrate epimerase
UniProt Protein Name
NAD(P)H-hydrate epimerase
Protein Family
UniProt Gene Name
APOA1BP
UniProt Synonym Gene Names
AIBP; YJEFN1; AI-BP; YjeF_N1
UniProt Entry Name
NNRE_HUMAN

NCBI Description

The product of this gene interacts with apolipoprotein A-I (apoA-I), the major apolipoprotein of high-density lipoproteins (HDLs). It is secreted into some bodily fluids, and its synthesis and secretion are stimulated in vitro by incubating cells with apoA-I. The human genome contains related pseudogenes. [provided by RefSeq, Jul 2008]

Uniprot Description

APOA1BP: Catalyzes the epimerization of the S- and R-forms of NAD(P)HX, a damaged form of NAD(P)H that is a result of enzymatic or heat-dependent hydration. This is a prerequisite for the S- specific NAD(P)H-hydrate dehydratase to allow the repair of both epimers of NAD(P)HX. Belongs to the nnrE/AIBP family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 5.1.99.6; Mitochondrial

Chromosomal Location of Human Ortholog: 1q21

Cellular Component: nucleoplasm; extracellular space; intracellular membrane-bound organelle; mitochondrion; cytoplasm; extracellular region; cilium

Molecular Function: protein binding; protein homodimerization activity; metal ion binding; nucleotide binding

Biological Process: NADH metabolic process; NADP metabolic process; protein homotetramerization

Research Articles on NAXE

Similar Products

Product Notes

The NAXE apoa1bp (Catalog #AAA9140643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAXE Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NAXE can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the NAXE apoa1bp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAXE, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.