Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FLJ37478 expression in transfected 293T cell line by FLJ37478 polyclonal antibody. Lane 1: FLJ37478 transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human NAT8L Polyclonal Antibody | anti-NAT8L antibody

NAT8L (N-acetylaspartate Synthetase, NAA Synthetase, Camello-like Protein 3, N-acetyltransferase 8-like Protein, CML3)

Gene Names
NAT8L; CML3; NACED; NAT8-LIKE
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NAT8L; Polyclonal Antibody; NAT8L (N-acetylaspartate Synthetase; NAA Synthetase; Camello-like Protein 3; N-acetyltransferase 8-like Protein; CML3); Anti -NAT8L (N-acetylaspartate Synthetase; anti-NAT8L antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NAT8L.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MADIEQYYMKPPGSCFWVAVLDGNVVGIVAARAHEEDNTVELLRMSVDSRFRGKGIAKALGRKVLEFAVVHNYSAVVLGTTAVKVAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Applicable Applications for anti-NAT8L antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NAT8L, aa1-134 (NP_848652).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FLJ37478 expression in transfected 293T cell line by FLJ37478 polyclonal antibody. Lane 1: FLJ37478 transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FLJ37478 expression in transfected 293T cell line by FLJ37478 polyclonal antibody. Lane 1: FLJ37478 transfected lysate (14.74kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NAT8L antibody
Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake.
Product Categories/Family for anti-NAT8L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32,837 Da
NCBI Official Full Name
N-acetylaspartate synthetase
NCBI Official Synonym Full Names
N-acetyltransferase 8-like (GCN5-related, putative)
NCBI Official Symbol
NAT8L
NCBI Official Synonym Symbols
CML3; NACED; NAT8-LIKE
NCBI Protein Information
N-acetylaspartate synthetase; NAA synthetase; camello-like protein 3
UniProt Protein Name
N-acetylaspartate synthetase
UniProt Gene Name
NAT8L
UniProt Synonym Gene Names
CML3; NAA synthetase
UniProt Entry Name
NAT8L_HUMAN

NCBI Description

This gene encodes a single-pass membrane protein, which contains a conserved sequence of the GCN5 or NAT superfamily of N-acetyltransferases and is a member of the N-acyltransferase (NAT) superfamily. This protein is a neuron-specific protein and is the N-acetylaspartate (NAA) biosynthetic enzyme, catalyzing the NAA synthesis from L-aspartate and acetyl-CoA. NAA is a major storage and transport form of acetyl coenzyme A specific to the nervous system. The gene mutation results in primary NAA deficiency (hypoacetylaspartia). [provided by RefSeq, Dec 2010]

Uniprot Description

NAT8L: Plays a role in the regulation of lipogenesis by producing N-acetylaspartate acid (NAA), a brain-specific metabolite. NAA occurs in high concentration in brain and its hydrolysis plays a significant part in the maintenance of intact white matter. Promotes dopamine uptake by regulating TNF-alpha expression. Attenuates methamphetamine-induced inhibition of dopamine uptake. Defects in NAT8L are the cause of N-acetylaspartate deficiency (NACED). A metabolic disorder resulting in truncal ataxia, marked developmental delay, seizures, and secondary microcephaly. Belongs to the camello family.

Protein type: EC 2.3.1.17; Acetyltransferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: mitochondrion; mitochondrial membrane; cytoplasm; integral to membrane; rough endoplasmic reticulum membrane

Molecular Function: aspartate N-acetyltransferase activity

Biological Process: positive regulation of dopamine uptake; metabolic process

Disease: N-acetylaspartate Deficiency

Research Articles on NAT8L

Similar Products

Product Notes

The NAT8L nat8l (Catalog #AAA641506) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NAT8L (N-acetylaspartate Synthetase, NAA Synthetase, Camello-like Protein 3, N-acetyltransferase 8-like Protein, CML3) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAT8L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NAT8L nat8l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MADIEQYYMK PPGSCFWVAV LDGNVVGIVA ARAHEEDNTV ELLRMSVDSR FRGKGIAKAL GRKVLEFAVV HNYSAVVLGT TAVKVAAHKL YESLGFRHMG ASDHYVLPGM TLSLAERLFF QVRYHRYRLQ LREE. It is sometimes possible for the material contained within the vial of "NAT8L, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.