Western Blot (WB)
(WB Suggested Anti-NAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Rabbit anti-Human NAT2 Polyclonal Antibody | anti-NAT2 antibody
NAT2 antibody - middle region
Gene Names
NAT2; AAC2; PNAT; NAT-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NAT2; Polyclonal Antibody; NAT2 antibody - middle region; anti-NAT2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
Antibody reacts with both NAT1 and NAT2
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLT
Sequence Length
290
Applicable Applications for anti-NAT2 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-NAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Western Blot (WB)
(WB Suggested Anti-NAT2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Western Blot (WB)
()
Western Blot (WB)
()
Related Product Information for anti-NAT2 antibody
This is a rabbit polyclonal antibody against NAT2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.
Target Description: NAT2 is a N-acetyltransferase 2 (arylamine N-acetyltransferase 2). This enzyme functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in its gene are reponsible for the N-acetylation polymorphism in which human populations segregate into rapid,intermediate, and slow acetylator phenotypes. Polymorphisms in NAT2 are also associated with higher incidences of cancer and drug toxicity.
Product Categories/Family for anti-NAT2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
arylamine N-acetyltransferase 2
NCBI Official Synonym Full Names
N-acetyltransferase 2
NCBI Official Symbol
NAT2
NCBI Official Synonym Symbols
AAC2; PNAT; NAT-2
NCBI Protein Information
arylamine N-acetyltransferase 2
UniProt Protein Name
Arylamine N-acetyltransferase 2
Protein Family
UniProt Gene Name
NAT2
UniProt Synonym Gene Names
AAC2; NAT-2; PNAT
UniProt Entry Name
ARY2_HUMAN
NCBI Description
This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second arylamine N-acetyltransferase gene (NAT1) is located near this gene (NAT2). [provided by RefSeq, Jul 2008]
Research Articles on NAT2
Similar Products
Product Notes
The NAT2 nat2 (Catalog #AAA3207254) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAT2 antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAT2 nat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TYRKFNYKDN TDLVEFKTLT EEEVEEVLRN IFKISLGRNL VPKPGDGSLT. It is sometimes possible for the material contained within the vial of "NAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
