Rabbit Nanog Polyclonal Antibody | anti-NANOG antibody

Anti-Nanog Antibody

Cat. Num. AAA178590

• Reactivity: Human, Mouse, Rat
• Applications: Western Blot
• Purity: Immunogen affinity purified.
• Synonyms: Nanog; Polyclonal Antibody; Anti-Nanog Antibody; ENK; NANOG; Q9H9S0; Homeobox protein NANOG; Nanog homeobox; anti-NANOG antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Purity/Purification: Immunogen affinity purified.
• Form/Format: Lyophilized; Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
• Sequence Length: 289

• Applicable Applications for anti-NANOG antibody: Western Blot (WB)
• Application Notes: Western Blot: 0.1-0.5ug/ml
• Notes: Tested Species: In-house tested species with positive results.; Other applications have not been tested.
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Immunogen: A synthetic peptide corresponding to a sequence in the middle region of human Nanog (115-155aa QRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQK), different from the related mouse sequence by three amino acids.
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of Nanog expression in rat ovary extract (lane 1), mouse ovary extract (lane 2) and MCF-7 whole cell lysates (lane 3). Nanog at 48KD was detected using rabbit anti- Nanog Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Related Product Information for anti-NANOG antibody

Rabbit IgG polyclonal antibody for Homeobox protein NANOG(NANOG) detection.
Background: NANOG (pron. nanOg) is a transcription factor critically involved with self-renewal of undifferentiated embryonic stem cells. In humans, this protein is encoded by the NANOG gene. It is mapped to 12p13.31. NANOG is thought to be a key factor in maintaining pluripotency. Moreover, NANOG is also thought to function in concert with other factors such as POU5F1 (Oct-4) and SOX2 to establish ESC identity. The NANOG protein has been found to be a transcriptional activator for the Rex1 promoter, playing a key role in sustaining Rex1 expression. Knockdown of NANOG in embryonic stem cells results in a reduction of Rex1 expression, while forced expression of NANOG stimulates Rex1 expression.

References

1. Chambers, I., Colby, D., Robertson, M., Nichols, J., Lee, S., Tweedie, S., Smith, A. Functional expression cloning of Nanog, a pluripotency sustaining factor in embryonic stem cells. Cell 113: 643-655, 2003.
2. Clark, A. T., Rodriguez, R. T., Bodnar, M. S., Abeyta, M. J., Cedars, M. I., Turek, P. J., Firpo, M. T., Pera, R. A. R. Human STELLAR, NANOG, and GDF3 genes are expressed in pluripotent cells and map to chromosome 12p13, a hotspot for teratocarcinoma. Stem Cells 22: 169-179, 2004.
3. Hart, A. H., Hartley, L., Ibrahim, M., Robb, L. Identification, cloning and expression analysis of the pluripotency promotingNanog genes in mouse and human. Dev. Dyn. 230: 187-198, 2004.

NCBI and Uniprot Product Information

• NCBI GI #: 663071050
• NCBI GeneID: 79923
• NCBI Accession #: NP_001284627.1
• NCBI GenBank Nucleotide #: NM_001297698.1
• UniProt Accession #: Q9H9S0; Q2TTG0; Q6JZS5; D3DUU4
• Molecular Weight: 32,838 Da
• NCBI Official Full Name: homeobox protein NANOG isoform 2
• NCBI Official Synonym Full Names: Nanog homeobox
• NCBI Official Symbol: NANOG
• NCBI Protein Information: homeobox protein NANOG
• UniProt Protein Name: Homeobox protein NANOG
• Protein Family: NANOG neighbor homeobox
• UniProt Gene Name: NANOG
• UniProt Synonym Gene Names: hNanog

NCBI Description

The protein encoded by this gene is a DNA binding homeobox transcription factor involved in embryonic stem (ES) cell proliferation, renewal, and pluripotency. The encoded protein can block ES cell differentiation and can also autorepress its own expression in differentiating cells. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2015]

Uniprot Description

NANOG: Transcription regulator involved in inner cell mass and embryonic stem (ES) cells proliferation and self-renewal. Imposes pluripotency on ES cells and prevents their differentiation towards extraembryonic endoderm and trophectoderm lineages. Blocks bone morphogenetic protein-induced mesoderm differentiation of ES cells by physically interacting with SMAD1 and interfering with the recruitment of coactivators to the active SMAD transcriptional complexes. Acts as a transcriptional activator or repressor. Binds optimally to the DNA consensus sequence 5'-TAAT[GT][GT]-3' or 5'-[CG][GA][CG]C[GC]ATTAN[GC]-3'. When overexpressed, promotes cells to enter into S phase and proliferation. Interacts with SMAD1 and SALL4. Expressed in testicular carcinoma and derived germ cell tumors. Expressed in fetal gonads, ovary and testis. Also expressed in ovary teratocarcinoma cell line and testicular embryonic carcinoma. Not expressed in many somatic organs and oocytes. Belongs to the Nanog homeobox family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell development/differentiation; DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 12p13.31

Cellular Component: nucleolus; nucleoplasm; nucleus

Molecular Function: DNA binding; protein binding; transcription corepressor activity; transcription factor activity

Biological Process: cell differentiation; cell proliferation; endodermal cell fate specification; positive regulation of transcription from RNA polymerase II promoter; regulation of cell differentiation; regulation of gene expression; regulation of transcription, DNA-dependent; somatic stem cell maintenance; stem cell maintenance