Western Blot (WB)
(Western Blot analysis of NACA2 expression in transfected 293T cell line by NACA2 polyclonal antibody. Lane 1: NACAL transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human NACAL Polyclonal Antibody | anti-NACA2 antibody
NACAL (NACA2, Nascent Polypeptide-associated Complex Subunit alpha-2, Alpha-NAC-like, Hom s 2.01, Nascent Polypeptide-associated Complex Subunit alpha-like, NAC-alpha-like)
Gene Names
NACA2; ANAC; NACAL
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
NACAL; Polyclonal Antibody; NACAL (NACA2; Nascent Polypeptide-associated Complex Subunit alpha-2; Alpha-NAC-like; Hom s 2.01; Nascent Polypeptide-associated Complex Subunit alpha-like; NAC-alpha-like); Anti -NACAL (NACA2; anti-NACA2 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NACAL.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MPGEATETVPATEQELPQSQAETGSGTASDSGESVPGIEEQDSTQTTTQKAWLVAAAEIDEEPVGKAKQSRSEKRARKAMSKLGLLQVTGVTRVTIWKSKNILFVITKLDVYKSPASDAYIVFGEAKIQDLSQQAQLAAAEKFRVQGEAVGNIQENTQTPTVQEESEEEEVDETGVEVKDVKLVMSQANVSRAKAVRALKNNSNDIVNAIMELTV
Applicable Applications for anti-NACA2 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human NACAL, aa1-215 (NP_954984.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of NACA2 expression in transfected 293T cell line by NACA2 polyclonal antibody. Lane 1: NACAL transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of NACA2 expression in transfected 293T cell line by NACA2 polyclonal antibody. Lane 1: NACAL transfected lysate (23.65kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to NACAL on HepG2 cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to NACAL on HepG2 cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-NACA2 antibody
Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites).
Product Categories/Family for anti-NACA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23,223 Da
NCBI Official Full Name
nascent polypeptide-associated complex subunit alpha-2
NCBI Official Synonym Full Names
nascent polypeptide-associated complex alpha subunit 2
NCBI Official Symbol
NACA2
NCBI Official Synonym Symbols
ANAC; NACAL
NCBI Protein Information
nascent polypeptide-associated complex subunit alpha-2; alpha-NAC protein; hom s 2.01 protein; IgE autoantigen alpha-nascent polypeptide-associated complex; nascent polypeptide-associated complex, alpha polypeptide, 2
UniProt Protein Name
Nascent polypeptide-associated complex subunit alpha-2
Protein Family
UniProt Gene Name
NACA2
UniProt Synonym Gene Names
NACAL; NAC-alpha-like
UniProt Entry Name
NACA2_HUMAN
Uniprot Description
NACA2: Prevents inappropriate targeting of non-secretory polypeptides to the endoplasmic reticulum (ER). Binds to nascent polypeptide chains as they emerge from the ribosome and blocks their interaction with the signal recognition particle (SRP), which normally targets nascent secretory peptides to the ER. Also reduces the inherent affinity of ribosomes for protein translocation sites in the ER membrane (M sites). Belongs to the NAC-alpha family.
Protein type: Unknown function
Chromosomal Location of Human Ortholog: 17q23.2
Cellular Component: cytoplasm; nucleus
Biological Process: protein transport
Research Articles on NACA2
Similar Products
Product Notes
The NACA2 naca2 (Catalog #AAA644618) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NACAL (NACA2, Nascent Polypeptide-associated Complex Subunit alpha-2, Alpha-NAC-like, Hom s 2.01, Nascent Polypeptide-associated Complex Subunit alpha-like, NAC-alpha-like) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NACAL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the NACA2 naca2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MPGEATETVP ATEQELPQSQ AETGSGTASD SGESVPGIEE QDSTQTTTQK AWLVAAAEID EEPVGKAKQS RSEKRARKAM SKLGLLQVTG VTRVTIWKSK NILFVITKLD VYKSPASDAY IVFGEAKIQD LSQQAQLAAA EKFRVQGEAV GNIQENTQTP TVQEESEEEE VDETGVEVKD VKLVMSQANV SRAKAVRALK NNSNDIVNAI MELTV. It is sometimes possible for the material contained within the vial of "NACAL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
