Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Naaladl2Sample Type: Human placenta lysateAntibody Dilution: 1.0ug/ml)

Rabbit Naaladl2 Polyclonal Antibody | anti-NAALADL2 antibody

Naaladl2 Antibody - C-terminal region

Gene Names
Naaladl2; Gm1021; EG635702; 2810043G22Rik
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Naaladl2; Polyclonal Antibody; Naaladl2 Antibody - C-terminal region; anti-NAALADL2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SLKGNEPSVPHLLALASRLRESAELFQSDEMRPANDPKERAPSRVRMLND
Sequence Length
795
Applicable Applications for anti-NAALADL2 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Rat: 93%; Yeast: 89%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Naaladl2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Naaladl2Sample Type: Human placenta lysateAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Naaladl2Sample Type: Human placenta lysateAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: Naaladl2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Naaladl2Sample Type: Mouse Liver lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NAALADL2 antibody
This is a rabbit polyclonal antibody against Naaladl2. It was validated on Western Blot

Target Description: The function of this protein remains unknown.
Product Categories/Family for anti-NAALADL2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
88kDa
NCBI Official Synonym Full Names
N-acetylated alpha-linked acidic dipeptidase-like 2
NCBI Official Symbol
Naaladl2
NCBI Official Synonym Symbols
Gm1021; EG635702; 2810043G22Rik
NCBI Protein Information
inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
UniProt Protein Name
Inactive N-acetylated-alpha-linked acidic dipeptidase-like protein 2
UniProt Gene Name
NAALADL2
UniProt Synonym Gene Names
NAALADase L2
UniProt Entry Name
NADL2_HUMAN

Uniprot Description

Function: May be catalytically inactive.

Subcellular location: Membrane; Single-pass type II membrane protein

Potential.

Tissue specificity: Expressed at higher level in kidney and placenta. In embryo, it is mainly confined to duodenal and stomach endoderm, mesonephros, metanephros and pancreas.

Miscellaneous: The gene maps to 3q26.31, a region associated with Cornelia de Lange syndrome. However, Ref.1 failed to identify specific mutations in a panel of DNA samples from patients with Cornelia de Lange syndrome.

Sequence similarities: Belongs to the peptidase M28 family. M28B subfamily.

Caution: Although related to the peptidase M28 family, it lacks the conserved zinc-binding and active sites and therefore has probably lost hydrolase activity.

Sequence caution: The sequence CAE54974.2 differs from that shown. Reason: Contaminating sequence at the C-terminus.The sequence CAH56310.1 differs from that shown. Reason: Frameshift at positions 509 and 518.

Similar Products

Product Notes

The NAALADL2 naaladl2 (Catalog #AAA3217384) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Naaladl2 Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rabbit, Rat, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Naaladl2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAALADL2 naaladl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SLKGNEPSVP HLLALASRLR ESAELFQSDE MRPANDPKER APSRVRMLND. It is sometimes possible for the material contained within the vial of "Naaladl2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.