Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ARD1A expression in transfected 293T cell line by ARD1A polyclonal antibody. Lane 1: ARD1A transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NAA10 Polyclonal Antibody | anti-NAA10 antibody

NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (HRP)

Gene Names
NAA10; TE2; ARD1; NATD; ARD1A; ARD1P; OGDNS; hARD1; DXS707; MCOPS1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NAA10; Polyclonal Antibody; NAA10 (ARD1; N-alpha-acetyltransferase 10; N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A; NatA Catalytic Subunit; ARD1A; TE2; DXS707; MGC71248) (HRP); anti-NAA10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ARD1A.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-NAA10 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ARD1A, aa1-235 (NP_003482.1).
Immunogen Sequence
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ARD1A expression in transfected 293T cell line by ARD1A polyclonal antibody. Lane 1: ARD1A transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ARD1A expression in transfected 293T cell line by ARD1A polyclonal antibody. Lane 1: ARD1A transfected lysate (26.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NAA10 antibody
In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration.
Product Categories/Family for anti-NAA10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
N-alpha-acetyltransferase 10 isoform 1
NCBI Official Synonym Full Names
N(alpha)-acetyltransferase 10, NatA catalytic subunit
NCBI Official Symbol
NAA10
NCBI Official Synonym Symbols
TE2; ARD1; NATD; ARD1A; ARD1P; OGDNS; hARD1; DXS707; MCOPS1
NCBI Protein Information
N-alpha-acetyltransferase 10
UniProt Protein Name
N-alpha-acetyltransferase 10
Protein Family
UniProt Gene Name
NAA10
UniProt Synonym Gene Names
ARD1; ARD1A; TE2
UniProt Entry Name
NAA10_HUMAN

NCBI Description

N-alpha-acetylation is among the most common post-translational protein modifications in eukaryotic cells. This process involves the transfer of an acetyl group from acetyl-coenzyme A to the alpha-amino group on a nascent polypeptide and is essential for normal cell function. This gene encodes an N-terminal acetyltransferase that functions as the catalytic subunit of the major amino-terminal acetyltransferase A complex. Mutations in this gene are the cause of Ogden syndrome. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

NAA10: In complex with NAA15, displays alpha (N-terminal) acetyltransferase activity. Without NAA15, displays epsilon (internal) acetyltransferase activity towards HIF1A, thereby promoting its degradation. Represses MYLK kinase activity by acetylation, and thus represses tumor cell migration. Interacts with HIF1A (via its ODD domain); the interaction increases HIF1A protein stability during normoxia, and down-regulates it when induced by hypoxia. Interacts with NAA15, NAA50 and with the ribosome. Binds to MYLK. Ubiquitous. Belongs to the acetyltransferase family. ARD1 subfamily.

Protein type: Amino Acid Metabolism - tyrosine; Secondary Metabolites Metabolism - limonene and pinene degradation; Amino Acid Metabolism - phenylalanine; EC 2.3.1.88; Lipid Metabolism - glycerophospholipid; Acetyltransferase

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: membrane; cytoplasm; nucleolus; intracellular; nucleus

Molecular Function: peptide alpha-N-acetyltransferase activity; N-acetyltransferase activity; protein binding; acetyltransferase activity; ribosome binding

Biological Process: N-terminal protein amino acid acetylation; N-terminal peptidyl-glutamic acid acetylation; internal protein amino acid acetylation; N-terminal peptidyl-serine acetylation; DNA packaging

Disease: Ogden Syndrome; Microphthalmia, Syndromic 1

Research Articles on NAA10

Similar Products

Product Notes

The NAA10 naa10 (Catalog #AAA6370214) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAA10 (ARD1, N-alpha-acetyltransferase 10, N-terminal Acetyltransferase Complex ARD1 Subunit Homolog A, NatA Catalytic Subunit, ARD1A, TE2, DXS707, MGC71248) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NAA10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NAA10 naa10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NAA10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.