Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYSM1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MYSM1 Polyclonal Antibody | anti-MYSM1 antibody

MYSM1 Antibody - N-terminal region

Gene Names
MYSM1; 2ADUB; BMFS4; 2A-DUB
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYSM1; Polyclonal Antibody; MYSM1 Antibody - N-terminal region; anti-MYSM1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KLIGSRTVLQVKSYARQYFKNKVKCGLDKETPNQKTGHNLQVKNEDKGTK
Sequence Length
828
Applicable Applications for anti-MYSM1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human MYSM1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYSM1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYSM1Sample Type: Hela Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYSM1 antibody
This is a rabbit polyclonal antibody against MYSM1. It was validated on Western Blot

Target Description: MYSM1 is a metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. It preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. MYSM1 acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation.
Product Categories/Family for anti-MYSM1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
91kDa
NCBI Official Full Name
histone H2A deubiquitinase MYSM1
NCBI Official Synonym Full Names
Myb like, SWIRM and MPN domains 1
NCBI Official Symbol
MYSM1
NCBI Official Synonym Symbols
2ADUB; BMFS4; 2A-DUB
NCBI Protein Information
histone H2A deubiquitinase MYSM1
UniProt Protein Name
Histone H2A deubiquitinase MYSM1
UniProt Gene Name
MYSM1
UniProt Synonym Gene Names
KIAA1915; 2A-DUB
UniProt Entry Name
MYSM1_HUMAN

Uniprot Description

MYSM1: Metalloprotease that specifically deubiquitinates monoubiquitinated histone H2A, a specific tag for epigenetic transcriptional repression, thereby acting as a coactivator. Preferentially deubiquitinates monoubiquitinated H2A in hyperacetylated nucleosomes. Deubiquitination of histone H2A leads to facilitate the phosphorylation and dissociation of histone H1 from the nucleosome. Acts as a coactivator by participating in the initiation and elongation steps of androgen receptor (AR)-induced gene activation. Belongs to the peptidase M67A family. MYSM1 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.-; Ubiquitin-specific protease; Protease; Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 1p32.1

Cellular Component: microtubule cytoskeleton; nucleoplasm; nucleus

Molecular Function: DNA binding; metallopeptidase activity; histone binding; metal ion binding; transcription coactivator activity; ubiquitin-specific protease activity; protein complex binding; chromatin binding

Biological Process: chromatin remodeling; transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; proteolysis

Research Articles on MYSM1

Similar Products

Product Notes

The MYSM1 mysm1 (Catalog #AAA3217383) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYSM1 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYSM1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYSM1 mysm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KLIGSRTVLQ VKSYARQYFK NKVKCGLDKE TPNQKTGHNL QVKNEDKGTK. It is sometimes possible for the material contained within the vial of "MYSM1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.