Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Rabbit anti-Human MYLC2PL Polyclonal Antibody | anti-MYLC2PL antibody

MYLC2PL (MYL10, Myosin Regulatory Light Chain 10, Myosin Light Chain 2, Lymphocyte-specific, Precursor Lymphocyte-specific Regulatory Light Chain, PLRLC, MGC3479) (Biotin)

Gene Names
MYL10; PLRLC; MYLC2PL
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MYLC2PL; Polyclonal Antibody; MYLC2PL (MYL10; Myosin Regulatory Light Chain 10; Myosin Light Chain 2; Lymphocyte-specific; Precursor Lymphocyte-specific Regulatory Light Chain; PLRLC; MGC3479) (Biotin); anti-MYLC2PL antibody
Ordering
 
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MYLC2PL.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-MYLC2PL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MYLC2PL, aa1-226 (NP_612412.2).
Immunogen Sequence
MLLRLVSNSWPQVILPPRPPKVLGLQAPRRARKRAEGTASSNVFSMFDQSQIQEFKESLALSPRLERNGMISAHCNLCLTGSSNSPASASQAFTIMDQNRDGFIDKEDLRDTFAALGRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGFVKADVIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRNLCYVITHGEEKD
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MYLC2PL expression in transfected 293T cell line by MYLC2PL polyclonal antibody. Lane 1: MYLC2PL transfected lysate (25.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MYLC2PL antibody
Myosin is a hexamer of 2 heavy chains and 4 light chains.
Product Categories/Family for anti-MYLC2PL antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,308 Da
NCBI Official Full Name
myosin regulatory light chain 10
NCBI Official Synonym Full Names
myosin, light chain 10, regulatory
NCBI Official Symbol
MYL10
NCBI Official Synonym Symbols
PLRLC; MYLC2PL
NCBI Protein Information
myosin regulatory light chain 10; myosin light chain 2, lymphocyte-specific; myosin light chain 2, precursor lymphocyte-specific; precursor lymphocyte-specific regulatory light chain
UniProt Protein Name
Myosin regulatory light chain 10
UniProt Gene Name
MYL10
UniProt Synonym Gene Names
MYLC2PL; PLRLC
UniProt Entry Name
MYL10_HUMAN

Similar Products

Product Notes

The MYLC2PL myl10 (Catalog #AAA6386294) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYLC2PL (MYL10, Myosin Regulatory Light Chain 10, Myosin Light Chain 2, Lymphocyte-specific, Precursor Lymphocyte-specific Regulatory Light Chain, PLRLC, MGC3479) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MYLC2PL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MYLC2PL myl10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MYLC2PL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.
Looking for a specific manual?
Request a Manual