Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MYH10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Rabbit MYH10 Polyclonal Antibody | anti-MYH10 antibody

MYH10 antibody - N-terminal region

Gene Names
MYH10; NMMHCB; NMMHC-IIB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYH10; Polyclonal Antibody; MYH10 antibody - N-terminal region; anti-MYH10 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WFPKATDKTFVEKLVQEQGSHSKFQKPRQLKDKADFCIIHYAGKVDYKAD
Sequence Length
1976
Applicable Applications for anti-MYH10 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MYH10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MYH10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)

Western Blot (WB) (WB Suggested Anti-MYH10 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Lung)
Related Product Information for anti-MYH10 antibody
This is a rabbit polyclonal antibody against MYH10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MYH10 is the cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping.
Product Categories/Family for anti-MYH10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
229kDa
NCBI Official Full Name
myosin-10 isoform 2
NCBI Official Synonym Full Names
myosin heavy chain 10
NCBI Official Symbol
MYH10
NCBI Official Synonym Symbols
NMMHCB; NMMHC-IIB
NCBI Protein Information
myosin-10
UniProt Protein Name
Myosin-10
Protein Family
UniProt Gene Name
MYH10
UniProt Synonym Gene Names
NMMHC-B; NMMHC II-b; NMMHC-IIB
UniProt Entry Name
MYH10_HUMAN

NCBI Description

This gene encodes a member of the myosin superfamily. The protein represents a conventional non-muscle myosin; it should not be confused with the unconventional myosin-10 (MYO10). Myosins are actin-dependent motor proteins with diverse functions including regulation of cytokinesis, cell motility, and cell polarity. Mutations in this gene have been associated with May-Hegglin anomaly and developmental defects in brain and heart. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2011]

Uniprot Description

MYH10: Cellular myosin that appears to play a role in cytokinesis, cell shape, and specialized functions such as secretion and capping. Involved with LARP6 in the stabilization of type I collagen mRNAs for CO1A1 and CO1A2. Myosin is a hexameric protein that consists of 2 heavy chain subunits (MHC), 2 alkali light chain subunits (MLC) and 2 regulatory light chain subunits (MLC-2). Interacts with PLEKHG6. Interacts with ECM29. Interacts with KIF26B. Interacts with LARP6. Isoform 1 is expressed in cerebellum and spinal chord. Isoform 2 is expressed in cerebrum and retina. Isoform 3 is expressed in the cerebrum and to a much lower extent in cerebellum. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Motor

Chromosomal Location of Human Ortholog: 17p13

Cellular Component: mitochondrion; myosin II complex; dendritic spine; actomyosin; cell cortex; actin cytoskeleton; growth cone; cell soma; axon; lamellipodium; cytoplasm; plasma membrane; stress fiber; spindle; midbody; neuromuscular junction; nucleus; myosin complex; cleavage furrow

Molecular Function: calmodulin binding; microfilament motor activity; actin filament binding; protein binding; ADP binding; actin-dependent ATPase activity; actin binding; ATP binding

Biological Process: adult heart development; axon guidance; exocytosis; metabolic process; actin filament-based movement; in utero embryonic development; fourth ventricle development; ventricular cardiac muscle cell development; actomyosin structure organization and biogenesis; cerebellar Purkinje cell layer development; neuron migration; cardiac myofibril assembly; third ventricle development; substrate-bound cell migration, cell extension; regulation of cell shape; cell proliferation; cytokinesis after mitosis; plasma membrane repair; retina development in camera-type eye; ephrin receptor signaling pathway; neuromuscular process controlling balance; cell adhesion; nuclear migration; lateral ventricle development

Research Articles on MYH10

Similar Products

Product Notes

The MYH10 myh10 (Catalog #AAA3206284) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYH10 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MYH10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYH10 myh10 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WFPKATDKTF VEKLVQEQGS HSKFQKPRQL KDKADFCIIH YAGKVDYKAD. It is sometimes possible for the material contained within the vial of "MYH10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.