Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MUTSample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MUT Polyclonal Antibody | anti-MUT antibody

MUT Antibody - middle region

Gene Names
MMUT; MCM; MUT
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MUT; Polyclonal Antibody; MUT Antibody - middle region; anti-MUT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: THRGYDSDNPRVRGDVGMAGVAIDTVEDTKILFDGIPLEKMSVSMTMNGA
Sequence Length
750
Applicable Applications for anti-MUT antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human MUT
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MUTSample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MUTSample Tissue: Human K562 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MUT antibody
This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria.
Product Categories/Family for anti-MUT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
82 kDa
NCBI Official Full Name
methylmalonyl-CoA mutase, mitochondrial
NCBI Official Synonym Full Names
methylmalonyl-CoA mutase
NCBI Official Symbol
MMUT
NCBI Official Synonym Symbols
MCM; MUT
NCBI Protein Information
methylmalonyl-CoA mutase, mitochondrial
UniProt Protein Name
Methylmalonyl-CoA mutase, mitochondrial
Protein Family
UniProt Gene Name
MUT
UniProt Synonym Gene Names
MCM
UniProt Entry Name
MUTA_HUMAN

NCBI Description

This gene encodes the mitochondrial enzyme methylmalonyl Coenzyme A mutase. In humans, the product of this gene is a vitamin B12-dependent enzyme which catalyzes the isomerization of methylmalonyl-CoA to succinyl-CoA, while in other species this enzyme may have different functions. Mutations in this gene may lead to various types of methylmalonic aciduria. [provided by RefSeq, Jul 2008]

Uniprot Description

MUT: Involved in the degradation of several amino acids, odd- chain fatty acids and cholesterol via propionyl-CoA to the tricarboxylic acid cycle. MCM has different functions in other species. Defects in MUT are the cause of methylmalonic aciduria type mut (MMAM). MMAM is an often fatal disorder of organic acid metabolism. Common clinical features include lethargy, vomiting, failure to thrive, hypotonia, neurological deficit and early death. Two forms of the disease are distinguished by the presence (mut-) or absence (mut0) of residual enzyme activity. Mut0 patients have more severe neurological manifestations of the disease than do MUT- patients. MMAM is unresponsive to vitamin B12 therapy. Belongs to the methylmalonyl-CoA mutase family.

Protein type: EC 5.4.99.2; Isomerase; Amino Acid Metabolism - valine, leucine and isoleucine degradation; Carbohydrate Metabolism - propanoate; Mitochondrial

Chromosomal Location of Human Ortholog: 6p12.3

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: methylmalonyl-CoA mutase activity; metal ion binding; cobalamin binding

Biological Process: vitamin metabolic process; fatty acid beta-oxidation; short-chain fatty acid catabolic process; cobalamin metabolic process; cellular lipid metabolic process; homocysteine metabolic process; water-soluble vitamin metabolic process; post-embryonic development

Disease: Methylmalonic Aciduria Due To Methylmalonyl-coa Mutase Deficiency

Research Articles on MUT

Similar Products

Product Notes

The MUT mut (Catalog #AAA3222307) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MUT Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MUT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MUT mut for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: THRGYDSDNP RVRGDVGMAG VAIDTVEDTK ILFDGIPLEK MSVSMTMNGA. It is sometimes possible for the material contained within the vial of "MUT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.