Western Blot (WB)
(Host: RabbitTarget Name: SKIV2L2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Human MTREX Polyclonal Antibody | anti-MTREX antibody
MTREX Antibody - N-terminal region
Gene Names
MTREX; Dob1; Mtr4; SKIV2L2; fSAP118; KIAA0052
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MTREX; Polyclonal Antibody; MTREX Antibody - N-terminal region; anti-MTREX antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: FEGDSTTAAGTKKDKEKDKGKWKGPPGSADKAGKRFDGKLQSESTNNGKN
Sequence Length
1042
Applicable Applications for anti-MTREX antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human SKIV2L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SKIV2L2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SKIV2L2Sample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Product Categories/Family for anti-MTREX antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
114 kDa
NCBI Official Full Name
exosome RNA helicase MTR4
NCBI Official Synonym Full Names
Mtr4 exosome RNA helicase
NCBI Official Symbol
MTREX
NCBI Official Synonym Symbols
Dob1; Mtr4; SKIV2L2; fSAP118; KIAA0052
NCBI Protein Information
exosome RNA helicase MTR4
UniProt Protein Name
Superkiller viralicidic activity 2-like 2
UniProt Gene Name
SKIV2L2
UniProt Synonym Gene Names
KIAA0052; Mtr4
UniProt Entry Name
SK2L2_HUMAN
Uniprot Description
SKIV2L2: May be involved in pre-mRNA splicing. Associated with the RNA exosome complex and involved in the 3'processing of the 7S pre-RNA to the mature 5.8S rRNA. Belongs to the helicase family. SKI2 subfamily.
Protein type: Spliceosome; EC 3.6.4.13; Nucleolus; DNA-binding; Helicase
Chromosomal Location of Human Ortholog: 5q11.2
Cellular Component: nucleoplasm; nucleolus; exosome (RNase complex); nucleus
Molecular Function: protein binding; helicase activity; ATP binding
Biological Process: nuclear mRNA splicing, via spliceosome; maturation of 5.8S rRNA
Research Articles on MTREX
Similar Products
Product Notes
The MTREX skiv2l2 (Catalog #AAA3221994) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTREX Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTREX can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTREX skiv2l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FEGDSTTAAG TKKDKEKDKG KWKGPPGSAD KAGKRFDGKL QSESTNNGKN. It is sometimes possible for the material contained within the vial of "MTREX, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
