Western Blot (WB)
(Western Blot analysis of MTF2 expression in transfected 293T cell line by MTF2 polyclonal antibody. Lane 1: MTF2 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)
Rabbit anti-Human MTF2 Polyclonal Antibody | anti-MTF2 antibody
MTF2 (Metal-response Element-binding Transcription Factor 2, Metal Regulatory Transcription Factor 2, Metal-response Element DNA-binding Protein M96, Polycomb-like protein 2, hPCl2, PCL2, dJ976O13.2, RP5-976O13.1)
Gene Names
MTF2; M96; PCL2; TDRD19A; dJ976O13.2; RP5-976O13.1
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MTF2; Polyclonal Antibody; MTF2 (Metal-response Element-binding Transcription Factor 2; Metal Regulatory Transcription Factor 2; Metal-response Element DNA-binding Protein M96; Polycomb-like protein 2; hPCl2; PCL2; dJ976O13.2; RP5-976O13.1); Anti -MTF2 (Metal-response Element-binding Transcription Factor 2; anti-MTF2 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MTF2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MRDSTGAGNSLVHKRSPLRRNQKTPTSLTKLSLQDGHKAKKPACKFEEGQDVLARWSDGLFYLGTIKKINILKQSCFIIFEDSSKSWVLWKDIQTGATGSGEMVCTICQEEYSEAPNEMVICDKCGQGYHQLCHTPHIDSSVIDSDEKWLCRQCVFATTTKRGGALKKGPNAKALQVMKQTLPYSVADLEWDAGHKTNVQQCYCYCGGPGDWYLKMLQCCKCKQWFHEACVQCLQKPMLFGDRFYTFICSVCSSGPEYLKRLPLQWVDIAHLCLYNLSVIHKKKYFDSELELMTYINENWDRLHPGELADTPKSERYEHVLEALNDYKTMEVSNGIEKKGKKKSVGRPPGPYTRKMIQKTAEPLLDKESISENPTLDLPCSIGRTEGTAHSSNTSDVDFTGASSAKETTSSSISRHYGLSDSRKRTRTGRSWPAAIPHLRRRRGRLPRRALQTQNSEIVKDDEGKEDYQFDELNTEILNNLADQELQLNHLKNSITSYFGAAGRIACGEKYRVLARRVTLDGKVQYLVEWEGATAS
Applicable Applications for anti-MTF2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MTF2, aa1-536 (AAH10013.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of MTF2 expression in transfected 293T cell line by MTF2 polyclonal antibody. Lane 1: MTF2 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MTF2 expression in transfected 293T cell line by MTF2 polyclonal antibody. Lane 1: MTF2 transfected lysate (60.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MTF2 antibody
Polycomb group (PcG) that specifically binds histone H3 trimethylated at 'Lys-36' (H3K36me3) and recruits the PRC2 complex. Acts by binding to H3K36me3, a mark for transcriptional activation, and recruiting the PRC2 complex, leading to enhance PRC2 H3K27me3 methylation activity. Regulates the transcriptional networks during embryonic stem cell self-renewal and differentiation. Promotes recruitment of the PRC2 complex to the inactive X chromosome in differentiating XX ES cells and PRC2 recruitment to target genes in undifferentiated ES cells. Required to repress Hox genes by enhancing H3K27me3 methylation of the PRC2 complex. In some conditions may act as an inhibitor of PRC2 activity: able to activate the CDKN2A gene and promote cellular senescence by suppressing the catalytic activity of the PRC2 complex locally. Binds to the metal-regulating-element (MRE) of MT1A gene promoter.
Product Categories/Family for anti-MTF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
Molecular Weight
67,106 Da
NCBI Official Full Name
MTF2 protein
NCBI Official Synonym Full Names
metal response element binding transcription factor 2
NCBI Official Symbol
MTF2
NCBI Official Synonym Symbols
M96; PCL2; TDRD19A; dJ976O13.2; RP5-976O13.1
NCBI Protein Information
metal-response element-binding transcription factor 2; hPCl2; polycomb-like 2; polycomb-like protein 2; tudor domain containing 19A; putative DNA binding protein; metal regulatory transcription factor 2; metal-response element DNA-binding protein M96; metal response element-binding transcription factor 2
UniProt Protein Name
Metal-response element-binding transcription factor 2
Protein Family
UniProt Gene Name
MTF2
UniProt Synonym Gene Names
PCL2; hPCl2
UniProt Entry Name
MTF2_HUMAN
Uniprot Description
MTF2: Binds to the metal-regulating-element (MRE) of metallothionein-1A gene promoter. Binding is zinc-dependent. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: DNA-binding
Chromosomal Location of Human Ortholog: 1p22.1
Cellular Component: nucleoplasm; ESC/E(Z) complex; cytoplasm; nucleus
Molecular Function: DNA binding; zinc ion binding; methylated histone residue binding
Biological Process: segment specification; negative regulation of gene expression, epigenetic; stem cell maintenance; positive regulation of transcription from RNA polymerase II promoter; gene expression; stem cell differentiation; chromatin modification; negative regulation of transcription from RNA polymerase II promoter; regulation of gene expression, epigenetic
Similar Products
Product Notes
The MTF2 mtf2 (Catalog #AAA6005116) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTF2 (Metal-response Element-binding Transcription Factor 2, Metal Regulatory Transcription Factor 2, Metal-response Element DNA-binding Protein M96, Polycomb-like protein 2, hPCl2, PCL2, dJ976O13.2, RP5-976O13.1) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MTF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MTF2 mtf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MRDSTGAGNS LVHKRSPLRR NQKTPTSLTK LSLQDGHKAK KPACKFEEGQ DVLARWSDGL FYLGTIKKIN ILKQSCFIIF EDSSKSWVLW KDIQTGATGS GEMVCTICQE EYSEAPNEMV ICDKCGQGYH QLCHTPHIDS SVIDSDEKWL CRQCVFATTT KRGGALKKGP NAKALQVMKQ TLPYSVADLE WDAGHKTNVQ QCYCYCGGPG DWYLKMLQCC KCKQWFHEAC VQCLQKPMLF GDRFYTFICS VCSSGPEYLK RLPLQWVDIA HLCLYNLSVI HKKKYFDSEL ELMTYINENW DRLHPGELAD TPKSERYEHV LEALNDYKTM EVSNGIEKKG KKKSVGRPPG PYTRKMIQKT AEPLLDKESI SENPTLDLPC SIGRTEGTAH SSNTSDVDFT GASSAKETTS SSISRHYGLS DSRKRTRTGR SWPAAIPHLR RRRGRLPRRA LQTQNSEIVK DDEGKEDYQF DELNTEILNN LADQELQLNH LKNSITSYFG AAGRIACGEK YRVLARRVTL DGKVQYLVEW EGATAS. It is sometimes possible for the material contained within the vial of "MTF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
