Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MTF1 Antibody Titration: 5.0ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysateMTF1 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit MTF1 Polyclonal Antibody | anti-MTF1 antibody

MTF1 antibody - C-terminal region

Gene Names
MTF1; ZRF; MTF-1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
MTF1; Polyclonal Antibody; MTF1 antibody - C-terminal region; anti-MTF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
Sequence Length
753
Applicable Applications for anti-MTF1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human MTF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MTF1 Antibody Titration: 5.0ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysateMTF1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-MTF1 Antibody Titration: 5.0ug/mlELISA Titer: 1:2500Positive Control: HepG2 cell lysateMTF1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-MTF1 antibody
This is a rabbit polyclonal antibody against MTF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
metal regulatory transcription factor 1
NCBI Official Synonym Full Names
metal regulatory transcription factor 1
NCBI Official Symbol
MTF1
NCBI Official Synonym Symbols
ZRF; MTF-1
NCBI Protein Information
metal regulatory transcription factor 1
UniProt Protein Name
Metal regulatory transcription factor 1
UniProt Gene Name
MTF1
UniProt Entry Name
MTF1_HUMAN

NCBI Description

This gene encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE). [provided by RefSeq, Jul 2008]

Uniprot Description

MTF1: Activates the metallothionein I promoter. Binds to the metal responsive element (MRE).

Protein type: Transcription factor; C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 1p33

Cellular Component: nucleoplasm; nucleus

Molecular Function: DNA binding; histone acetyltransferase binding; metal ion binding; protein binding; transcription coactivator activity; transcription factor activity

Biological Process: positive regulation of transcription from RNA polymerase II promoter; regulation of transcription from RNA polymerase II promoter; response to cadmium ion; response to metal ion; response to oxidative stress; transcription from RNA polymerase II promoter

Research Articles on MTF1

Similar Products

Product Notes

The MTF1 mtf1 (Catalog #AAA3200715) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTF1 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTF1 mtf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QSSLVMGEQN LQWILNGATS SPQNQEQIQQ ASKVEKVFFT TAVPVASSPG. It is sometimes possible for the material contained within the vial of "MTF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.