Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMTCH2 is supported by BioGPS gene expression data to be expressed in 721_B)

Rabbit MTCH2 Polyclonal Antibody | anti-MTCH2 antibody

MTCH2 antibody - N-terminal region

Gene Names
MTCH2; MIMP; HSPC032; SLC25A50
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MTCH2; Polyclonal Antibody; MTCH2 antibody - N-terminal region; anti-MTCH2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQL
Sequence Length
303
Applicable Applications for anti-MTCH2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 77%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MTCH2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMTCH2 is supported by BioGPS gene expression data to be expressed in 721_B)

Western Blot (WB) (WB Suggested Anti-MTCH2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: 721_B cell lysateMTCH2 is supported by BioGPS gene expression data to be expressed in 721_B)
Related Product Information for anti-MTCH2 antibody
This is a rabbit polyclonal antibody against MTCH2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MTCH2 belongs to the mitochondrial carrier family. It contains 2 Solcar repeats. The substrate transported is not yet known. It induces mitochondrial depolarization.
Product Categories/Family for anti-MTCH2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
mitochondrial carrier homolog 2 isoform 1
NCBI Official Synonym Full Names
mitochondrial carrier 2
NCBI Official Symbol
MTCH2
NCBI Official Synonym Symbols
MIMP; HSPC032; SLC25A50
NCBI Protein Information
mitochondrial carrier homolog 2
UniProt Protein Name
Mitochondrial carrier homolog 2
Protein Family
UniProt Gene Name
MTCH2
UniProt Synonym Gene Names
MIMP
UniProt Entry Name
MTCH2_HUMAN

NCBI Description

This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target that can produce two isoforms from the same mRNA by use of alternative in-frame translation termination codons. [provided by RefSeq, Dec 2017]

Uniprot Description

MTCH2: The substrate transported is not yet known. Induces mitochondrial depolarization. Belongs to the mitochondrial carrier family.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Mitochondrial

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: mitochondrial outer membrane; membrane; mitochondrial inner membrane; integral to membrane; nucleus

Research Articles on MTCH2

Similar Products

Product Notes

The MTCH2 mtch2 (Catalog #AAA3212007) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTCH2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MTCH2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MTCH2 mtch2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ADAASQVLLG SGLTILSQPL MYVKVLIQVG YEPLPPTIGR NIFGRQVCQL. It is sometimes possible for the material contained within the vial of "MTCH2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.