Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (MSX1 rabbit polyclonal antibody. Western Blot analysis of MSX1 expression in Jurkat.)

Rabbit anti-Human MSX1 Polyclonal Antibody | anti-MSX1 antibody

MSX1 (Homeobox Protein MSX-1, Homeobox Protein Hox-7, Msh Homeobox 1-like Protein, HOX7) (HRP)

Gene Names
MSX1; HOX7; HYD1; ECTD3; STHAG1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
MSX1; Polyclonal Antibody; MSX1 (Homeobox Protein MSX-1; Homeobox Protein Hox-7; Msh Homeobox 1-like Protein; HOX7) (HRP); anti-MSX1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MSX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-MSX1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human MSX1, aa1-297 (AAH67353.1).
Immunogen Sequence
MTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLPFSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(MSX1 rabbit polyclonal antibody. Western Blot analysis of MSX1 expression in Jurkat.)

Western Blot (WB) (MSX1 rabbit polyclonal antibody. Western Blot analysis of MSX1 expression in Jurkat.)

Western Blot (WB)

(Western Blot analysis of MSX1 expression in transfected 293T cell line by MSX1 polyclonal antibody. Lane 1: MSX1 transfected lysate (30.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MSX1 expression in transfected 293T cell line by MSX1 polyclonal antibody. Lane 1: MSX1 transfected lysate (30.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MSX1 antibody
HOX7 is a 297aa novel member of homeodomain family of DNA binding domain family (meta HOX) that functions as a DNA-associated transcription factor. It has a helix-turn-helix and DNA binding domain. It plays an important role in inhibiting MYOD1 expression and is involved in epithelial-mesenchymal signaling in many organs, playing a role in limb-pattern formation. It acts as a potential repressor in cell cycle progression and as a RNA polymerase 2 transcription factor, involved in skeletal development. Northern blot analysis detects highest expression of HOX7 in heart along with other tissues like prostate and highly in dental mesenchyme during critical bud stage, placenta, etc.
Product Categories/Family for anti-MSX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
31
NCBI Official Full Name
MSX1 protein
NCBI Official Synonym Full Names
msh homeobox 1
NCBI Official Symbol
MSX1
NCBI Official Synonym Symbols
HOX7; HYD1; ECTD3; STHAG1
NCBI Protein Information
homeobox protein MSX-1
Protein Family

NCBI Description

This gene encodes a member of the muscle segment homeobox gene family. The encoded protein functions as a transcriptional repressor during embryogenesis through interactions with components of the core transcription complex and other homeoproteins. It may also have roles in limb-pattern formation, craniofacial development, particularly odontogenesis, and tumor growth inhibition. Mutations in this gene, which was once known as homeobox 7, have been associated with nonsyndromic cleft lip with or without cleft palate 5, Witkop syndrome, Wolf-Hirschom syndrome, and autosomoal dominant hypodontia. [provided by RefSeq, Jul 2008]

Research Articles on MSX1

Similar Products

Product Notes

The MSX1 (Catalog #AAA6386032) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MSX1 (Homeobox Protein MSX-1, Homeobox Protein Hox-7, Msh Homeobox 1-like Protein, HOX7) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MSX1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the MSX1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MSX1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.