Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MRPS26Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MRPS26 Polyclonal Antibody | anti-MRPS26 antibody

MRPS26 Antibody - C-terminal region

Gene Names
MRPS26; GI008; MRPS13; RPMS13; MRP-S13; MRP-S26; NY-BR-87; C20orf193; dJ534B8.3
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Yeast, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MRPS26; Polyclonal Antibody; MRPS26 Antibody - C-terminal region; anti-MRPS26 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Yeast, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: RQALEQARKAEEVQAWAQRKEREVLQLQEEVKNFITRENLEARVEAALDS
Sequence Length
205
Applicable Applications for anti-MRPS26 antibody
Western Blot (WB)
Homology
Cow: 82%; Dog: 86%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 91%; Yeast: 83%; Zebrafish: 82%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MRPS26
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MRPS26Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MRPS26Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MRPS26 antibody
This is a rabbit polyclonal antibody against MRPS26. It was validated on Western Blot

Target Description: Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. This gene lies adjacent to and downstream of the gonadotropin-releasing hormone precursor gene.
Product Categories/Family for anti-MRPS26 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
28S ribosomal protein S26, mitochondrial
NCBI Official Synonym Full Names
mitochondrial ribosomal protein S26
NCBI Official Symbol
MRPS26
NCBI Official Synonym Symbols
GI008; MRPS13; RPMS13; MRP-S13; MRP-S26; NY-BR-87; C20orf193; dJ534B8.3
NCBI Protein Information
28S ribosomal protein S26, mitochondrial
UniProt Protein Name
28S ribosomal protein S26, mitochondrial
Protein Family
UniProt Gene Name
MRPS26
UniProt Synonym Gene Names
C20orf193; RPMS13; MRP-S26; S26mt; MRP-S13; S13mt
UniProt Entry Name
RT26_HUMAN

NCBI Description

Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein. This gene lies adjacent to and downstream of the gonadotropin-releasing hormone precursor gene. [provided by RefSeq, Jul 2008]

Research Articles on MRPS26

Similar Products

Product Notes

The MRPS26 mrps26 (Catalog #AAA3217963) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MRPS26 Antibody - C-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Yeast, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's MRPS26 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MRPS26 mrps26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: RQALEQARKA EEVQAWAQRK EREVLQLQEE VKNFITRENL EARVEAALDS. It is sometimes possible for the material contained within the vial of "MRPS26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.