Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Figure 1. Western blot analysis of MRP1 using anti-MRP1 antibody (MBS178626).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MRP1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MRP1 at approximately 220KD. The expected band size for MRP1 is at 220KD. )

Rabbit anti-Human MRP1 Polyclonal Antibody | anti-ABCC1 antibody

Anti-MRP1 Antibody

Gene Names
ABCC1; MRP; ABCC; GS-X; MRP1; ABC29
Reactivity
Human
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
MRP1; Polyclonal Antibody; Anti-MRP1 Antibody; ABCC1; Leukotriene C transporter; Leukotriene C(4) transporter; LTC4 transporter; MRP; MRP-1; P33527; Multidrug resistance-associated protein 1; ATP-binding cassette; sub-family C (CFTR/MRP); member 1; anti-ABCC1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
1531
Applicable Applications for anti-ABCC1 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MRP1 (1493-1528aa DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA), different from the related mouse sequence by five amino acids, and from the related rat sequence by four amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Figure 1. Western blot analysis of MRP1 using anti-MRP1 antibody (MBS178626).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MRP1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MRP1 at approximately 220KD. The expected band size for MRP1 is at 220KD. )

Western Blot (WB) (Figure 1. Western blot analysis of MRP1 using anti-MRP1 antibody (MBS178626).Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions.lane 1: HELA whole cell lysates,lane 2: A549 whole cell lysates.After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-MRP1 antigen affinity purified polyclonal antibody at 0.5ug/mL overnight at 4 degree C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit with Tanon 5200 system. A specific band was detected for MRP1 at approximately 220KD. The expected band size for MRP1 is at 220KD. )
Related Product Information for anti-ABCC1 antibody
Rabbit IgG polyclonal antibody for Multidrug resistance-associated protein 1(ABCC1) detection.
Background: Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.
References
1. "Entrez Gene: ABCC1 ATP-binding cassette, sub-family C (CFTR/MRP), member 1".
2. Rosenberg MF, Mao Q, Holzenburg A, Ford RC, Deeley RG, Cole SP (May 2001). "The structure of the multidrug resistance protein 1 (MRP1/ABCC1). crystallization and single-particle analysis". The Journal of Biological Chemistry. 276 (19): 16076-82.
3. Yin J, Zhang J (October 2011). "Multidrug resistance-associated protein 1 (MRP1/ABCC1) polymorphism: from discovery to clinical application". Zhong Nan Da Xue Xue Bao. Yi Xue Ban = Journal of Central South University. Medical Sciences. 36 (10): 927-38.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
172,640 Da
NCBI Official Full Name
multidrug resistance-associated protein 1
NCBI Official Synonym Full Names
ATP binding cassette subfamily C member 1
NCBI Official Symbol
ABCC1
NCBI Official Synonym Symbols
MRP; ABCC; GS-X; MRP1; ABC29
NCBI Protein Information
multidrug resistance-associated protein 1
UniProt Protein Name
Multidrug resistance-associated protein 1
UniProt Gene Name
ABCC1
UniProt Synonym Gene Names
MRP; MRP1; LTC4 transporter

NCBI Description

The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown. [provided by RefSeq, Apr 2012]

Uniprot Description

ABCC1: a multi-pass membrane protein. A multidrug resistance member of the ABC transporter family that confers resistance to anticancer drugs. A multi-pass membrane protein. Exports sphingosine-1-phosphate (S1P), a potent inflammatory mediator, from mast cells during mast cell-mediated immune responses. Nine alternatively spliced human isoforms have been reported.

Protein type: Membrane protein, integral; Membrane protein, multi-pass; Transporter; Transporter, ABC family

Chromosomal Location of Human Ortholog: 16p13.11

Cellular Component: basolateral plasma membrane; integral to plasma membrane; membrane; plasma membrane

Molecular Function: anion transmembrane-transporting ATPase activity; ATPase activity; ATPase activity, coupled to transmembrane movement of substances; cobalamin-transporting ATPase activity; transporter activity

Biological Process: cobalamin metabolic process; leukotriene metabolic process; response to drug; transmembrane transport; transport

Research Articles on ABCC1

Similar Products

Product Notes

The ABCC1 abcc1 (Catalog #AAA178626) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-MRP1 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MRP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ABCC1 abcc1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MRP1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.