Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MPPED2 expression in transfected 293T cell line by MPPED2 polyclonal antibody. Lane 1: MPPED2 transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MPPED2 Polyclonal Antibody | anti-MPPED2 antibody

MPPED2 (Metallophosphoesterase MPPED2, Fetal Brain Protein 239, 239FB, Metallophosphoesterase Domain-containing Protein 2, C11orf8, FAM1B)

Gene Names
MPPED2; 239FB; C11orf8
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
MPPED2; Polyclonal Antibody; MPPED2 (Metallophosphoesterase MPPED2; Fetal Brain Protein 239; 239FB; Metallophosphoesterase Domain-containing Protein 2; C11orf8; FAM1B); Anti -MPPED2 (Metallophosphoesterase MPPED2; anti-MPPED2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MPPED2.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Applicable Applications for anti-MPPED2 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MPPED2, aa1-294 (NP_001575.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MPPED2 expression in transfected 293T cell line by MPPED2 polyclonal antibody. Lane 1: MPPED2 transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MPPED2 expression in transfected 293T cell line by MPPED2 polyclonal antibody. Lane 1: MPPED2 transfected lysate (33.4kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-MPPED2 antibody
MMPED2 (Metallophosphoesterase domain containing 2) displays low metallophosphoesterase activity (in vitro). It is predominantly expressed in the fetal brain and is thought to have a role in development of the nervous system. Alternatively spliced transcript variants have been described.
Product Categories/Family for anti-MPPED2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
744
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33,360 Da
NCBI Official Full Name
metallophosphoesterase MPPED2 isoform 2
NCBI Official Synonym Full Names
metallophosphoesterase domain containing 2
NCBI Official Symbol
MPPED2
NCBI Official Synonym Symbols
239FB; C11orf8
NCBI Protein Information
metallophosphoesterase MPPED2; fetal brain protein 239; metallophosphoesterase domain-containing protein 2
UniProt Protein Name
Metallophosphoesterase MPPED2
Protein Family
UniProt Gene Name
MPPED2
UniProt Synonym Gene Names
C11orf8; FAM1B; 239FB
UniProt Entry Name
MPPD2_HUMAN

NCBI Description

This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2009]

Uniprot Description

Function: Displays low metallophosphoesterase activity (in vitro). May play a role in the development of the nervous system

By similarity.

Cofactor: Manganese or cobalt

By similarity.

Subunit structure: Homodimer

By similarity.

Tissue specificity: Expressed predominantly in fetal brain.

Sequence similarities: Belongs to the UPF0046 family.

Sequence caution: The sequence BAD92400.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Research Articles on MPPED2

Similar Products

Product Notes

The MPPED2 mpped2 (Catalog #AAA645926) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MPPED2 (Metallophosphoesterase MPPED2, Fetal Brain Protein 239, 239FB, Metallophosphoesterase Domain-containing Protein 2, C11orf8, FAM1B) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MPPED2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the MPPED2 mpped2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAHGIPSQGK VTITVDEYSS NPTQAFTHYN INQSRFQPPH VHMVDPIPYD TPKPAGHTRF VCISDTHSRT DGIQMPYGDI LLHTGDFTEL GLPSEVKKFN DWLGNLPYEY KIVIAGNHEL TFDKEFMADL VKQDYYRFPS VSKLKPEDFD NVQSLLTNSI YLQDSEVTVK GFRIYGAPWT PWFNGWGFNL PRGQSLLDKW NLIPEGIDIL MTHGPPLGFR DWVPKELQRV GCVELLNTVQ RRVRPKLHVF GGIHEGYGIM TDGYTTYINA STCTVSFQPT NPPIIFDLPN PQGS. It is sometimes possible for the material contained within the vial of "MPPED2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.