Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-Morf4l1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Rabbit Morf4l1 Polyclonal Antibody | anti-MORF4L1 antibody

Morf4l1 antibody - middle region

Gene Names
Morf4l1; MRG15; Tex189; TEG-189; MORFRG15; mKIAA4002
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Morf4l1; Polyclonal Antibody; Morf4l1 antibody - middle region; anti-MORF4L1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQQKNVEVKTKKNKQKTPGNGDGGSTSETPQPPRKKRARVDPTVENEETF
Sequence Length
362
Applicable Applications for anti-MORF4L1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 93%; Mouse: 93%; Pig: 93%; Rabbit: 93%; Rat: 93%; Zebrafish: 85%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-Morf4l1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)

Western Blot (WB) (WB Suggested Anti-Morf4l1 AntibodyTitration: 1.0 ug/mlPositive Control: Mouse Small Intestine)
Related Product Information for anti-MORF4L1 antibody
This is a rabbit polyclonal antibody against Morf4l1. It was validated on Western Blot

Target Description: Morf4l1 is a component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. The NuA4 complex ATPase and helicase activities seem to be, at least in part, contributed by the association of RUVBL1 and RUVBL2 with EP400. NuA4 may also play a direct role in DNA repair when directly recruited to sites of DNA damage.
Product Categories/Family for anti-MORF4L1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
mortality factor 4-like protein 1 isoform a
NCBI Official Synonym Full Names
mortality factor 4 like 1
NCBI Official Symbol
Morf4l1
NCBI Official Synonym Symbols
MRG15; Tex189; TEG-189; MORFRG15; mKIAA4002
NCBI Protein Information
mortality factor 4-like protein 1
UniProt Protein Name
Mortality factor 4-like protein 1
UniProt Gene Name
Morf4l1
UniProt Synonym Gene Names
Mrg15; Tex189
UniProt Entry Name
MO4L1_MOUSE

Research Articles on MORF4L1

Similar Products

Product Notes

The MORF4L1 morf4l1 (Catalog #AAA3208663) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Morf4l1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Morf4l1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MORF4L1 morf4l1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQQKNVEVKT KKNKQKTPGN GDGGSTSETP QPPRKKRARV DPTVENEETF. It is sometimes possible for the material contained within the vial of "Morf4l1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.