Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of MOCS3 expression in transfected 293T cell line by MOCS3 polyclonal antibody. Lane 1: MOCS3 transfected lysate (49.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human MOCS3 Polyclonal Antibody

MOCS3 (Adenylyltransferase and Sulfurtransferase MOCS3, Molybdenum Cofactor Synthesis Protein 3, Molybdopterin Synthase Sulfurylase, MPT Synthase Sulfurylase, UBA4, dJ914P20.3, MGC9252)

Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
MOCS3; Polyclonal Antibody; MOCS3 (Adenylyltransferase and Sulfurtransferase MOCS3; Molybdenum Cofactor Synthesis Protein 3; Molybdopterin Synthase Sulfurylase; MPT Synthase Sulfurylase; UBA4; dJ914P20.3; MGC9252); Anti -MOCS3 (Adenylyltransferase and Sulfurtransferase MOCS3; anti-MOCS3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MOCS3.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MASREEVLALQAEVAQREEELNSLKQKLASALLAEQEPQPERLVPVSPLPPKAALSRDEILRYSRQLVLPELGVHGQLRLGTACVLIVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKAFSAAASLRRLNSAVECVPYTQALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLAGRPLVSASALRFEGQITVYHYDGGPCYRCIFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLLFDALRGHFRSIRLRSRRLDCAACGERPTVTDLLDYEAFCGSSATDKCRSLQLLSPEERVSVTDYKRLLDSGAFHLLLDVRPQVEVDICRLPHALHIPLKHLERRDAESLKLLKEAIWEEKQGTQEGAAVPIYVICKLGNDSQKAVKILQSLSAAQELDPLTVRDVVGGLMAWAAKIDGTFPQY
Applicable Applications for anti-MOCS3 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human MOCS3, aa1-460 (NP_055299.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MOCS3 expression in transfected 293T cell line by MOCS3 polyclonal antibody. Lane 1: MOCS3 transfected lysate (49.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of MOCS3 expression in transfected 293T cell line by MOCS3 polyclonal antibody. Lane 1: MOCS3 transfected lysate (49.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of MOCS3 transfected lysate using MOCS3 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MOCS3 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of MOCS3 transfected lysate using MOCS3 rabbit polyclonal antibody and Protein A Magnetic Bead, and immunoblotted with MOCS3 mouse polyclonal antibody.)
Related Product Information for anti-MOCS3 antibody
Plays a central role in 2-thiolation of mcm5S2U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Also essential during biosynthesis of the molybdenum cofactor. Acts by mediating the C-terminal thiocarboxylation of sulfur carriers URM1 and MOCS2A. Its N-terminus first activates URM1 and MOCS2A as acyl-adenylates (-COAMP), then the persulfide sulfur on the catalytic cysteine is transferred to URM1 and MOCS2A to form thiocarboxylation (-COSH) of their C-terminus. The reaction probably involves hydrogen sulfide that is generated from the persulfide intermediate and that acts as nucleophile towards URM1 and MOCS2A. Subsequently, a transient disulfide bond is formed. Does not use thiosulfate as sulfur donor; NFS1 probably acting as a sulfur donor for thiocarboxylation reactions.
Product Categories/Family for anti-MOCS3 antibody

Similar Products

Product Notes

The MOCS3 (Catalog #AAA6011078) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MOCS3 (Adenylyltransferase and Sulfurtransferase MOCS3, Molybdenum Cofactor Synthesis Protein 3, Molybdopterin Synthase Sulfurylase, MPT Synthase Sulfurylase, UBA4, dJ914P20.3, MGC9252) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MOCS3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the MOCS3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MASREEVLAL QAEVAQREEE LNSLKQKLAS ALLAEQEPQP ERLVPVSPLP PKAALSRDEI LRYSRQLVLP ELGVHGQLRL GTACVLIVGC GGLGCPLAQY LAAAGVGRLG LVDYDVVEMS NLARQVLHGE ALAGQAKAFS AAASLRRLNS AVECVPYTQA LTPATALDLV RRYDVVADCS DNVPTRYLVN DACVLAGRPL VSASALRFEG QITVYHYDGG PCYRCIFPQP PPAETVTNCA DGGVLGVVTG VLGCLQALEV LKIAAGLGPS YSGSLLLFDA LRGHFRSIRL RSRRLDCAAC GERPTVTDLL DYEAFCGSSA TDKCRSLQLL SPEERVSVTD YKRLLDSGAF HLLLDVRPQV EVDICRLPHA LHIPLKHLER RDAESLKLLK EAIWEEKQGT QEGAAVPIYV ICKLGNDSQK AVKILQSLSA AQELDPLTVR DVVGGLMAWA AKIDGTFPQY. It is sometimes possible for the material contained within the vial of "MOCS3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.