Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MMP27Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human MMP27 Polyclonal Antibody | anti-MMP27 antibody

MMP27 Antibody - middle region

Gene Names
MMP27; MMP-27
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MMP27; Polyclonal Antibody; MMP27 Antibody - middle region; anti-MMP27 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNLF
Sequence Length
223
Applicable Applications for anti-MMP27 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMP27
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MMP27Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MMP27Sample Tissue: Human DLD1 Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MMP27 antibody
Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases.
Product Categories/Family for anti-MMP27 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
matrix metalloproteinase-27
NCBI Official Synonym Full Names
matrix metallopeptidase 27
NCBI Official Symbol
MMP27
NCBI Official Synonym Symbols
MMP-27
NCBI Protein Information
matrix metalloproteinase-27
UniProt Protein Name
Matrix metalloproteinase-27
Protein Family
UniProt Gene Name
MMP27
UniProt Synonym Gene Names
MMP-27
UniProt Entry Name
MMP27_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP27: Matrix metalloproteinases degrade protein components of the extracellular matrix such as fibronectin, laminin, gelatins and/or collagens. Belongs to the peptidase M10A family.

Protein type: Secreted; Protease; EC 3.4.24.-; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11q24

Cellular Component: extracellular matrix

Molecular Function: zinc ion binding; metalloendopeptidase activity; calcium ion binding

Biological Process: collagen catabolic process; proteolysis

Research Articles on MMP27

Similar Products

Product Notes

The MMP27 mmp27 (Catalog #AAA3220703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP27 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP27 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP27 mmp27 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TRVHGRCPRY FDGPLGVLGH AFPPGPGLGG DTHFDEDENW TKDGAGFNLF. It is sometimes possible for the material contained within the vial of "MMP27, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.