Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MMP17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit MMP17 Polyclonal Antibody | anti-MMP17 antibody

MMP17 antibody - C-terminal region

Gene Names
MMP17; MMP-17; MT4MMP; MTMMP4; MT4-MMP
Reactivity
Cow, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MMP17; Polyclonal Antibody; MMP17 antibody - C-terminal region; anti-MMP17 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YPQSTARDWLVCGDSQADGSVAAGVDAAEGPRAPPGQHDQSRSEDGYEVC
Sequence Length
603
Applicable Applications for anti-MMP17 antibody
Western Blot (WB)
Homology
Cow: 79%; Horse: 93%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MMP17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-MMP17 AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-MMP17 antibody
This is a rabbit polyclonal antibody against MMP17. It was validated on Western Blot

Target Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene is considered a member of the membrane-type MMP (MT-MMP) subfamily. However, this protein is unique among the MT-MMP's in that it is a GPI-anchored protein rather than a transmembrane protein. The protein activates MMP-2 by cleavage.
Product Categories/Family for anti-MMP17 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
matrix metalloproteinase-17 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 17
NCBI Official Symbol
MMP17
NCBI Official Synonym Symbols
MMP-17; MT4MMP; MTMMP4; MT4-MMP
NCBI Protein Information
matrix metalloproteinase-17
UniProt Protein Name
Matrix metalloproteinase-17
Protein Family
UniProt Gene Name
MMP17
UniProt Synonym Gene Names
MT4MMP; MMP-17; MT-MMP 4; MTMMP4; MT4-MMP; MT4MMP
UniProt Entry Name
MMP17_HUMAN

NCBI Description

This gene encodes a member of the peptidase M10 family and membrane-type subfamily of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Members of this subfamily contain a transmembrane domain suggesting that these proteins are expressed at the cell surface rather than secreted. The encoded preproprotein is proteolytically processed to generate the mature protease. This protein is unique among the membrane-type matrix metalloproteinases in that it is anchored to the cell membrane via a glycosylphosphatidylinositol (GPI) anchor. Elevated expression of the encoded protein has been observed in osteoarthritis and multiple human cancers. [provided by RefSeq, Jan 2016]

Uniprot Description

MMP17: Endopeptidase that degrades various components of the extracellular matrix, such as fibrin. May be involved in the activation of membrane-bound precursors of growth factors or inflammatory mediators, such as tumor necrosis factor-alpha. May also be involved in tumoral process. Not obvious if able to proteolytically activate progelatinase A. Does not hydrolyze collagen types I, II, III, IV and V, gelatin, fibronectin, laminin, decorin nor alpha1-antitrypsin. Belongs to the peptidase M10A family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Activator; Protease; Membrane protein, integral; EC 3.4.24.-; Membrane protein, GPI anchor

Chromosomal Location of Human Ortholog: 12q24.3

Cellular Component: proteinaceous extracellular matrix; integral to plasma membrane

Molecular Function: zinc ion binding; metalloendopeptidase activity; enzyme activator activity; calcium ion binding

Biological Process: positive regulation of catalytic activity; proteolysis

Research Articles on MMP17

Similar Products

Product Notes

The MMP17 mmp17 (Catalog #AAA3216468) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP17 antibody - C-terminal region reacts with Cow, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP17 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP17 mmp17 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YPQSTARDWL VCGDSQADGS VAAGVDAAEG PRAPPGQHDQ SRSEDGYEVC. It is sometimes possible for the material contained within the vial of "MMP17, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.