Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MMP11Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human MMP11 Polyclonal Antibody | anti-MMP11 antibody

MMP11 Antibody - middle region

Gene Names
MMP11; ST3; SL-3; STMY3
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
MMP11; Polyclonal Antibody; MMP11 Antibody - middle region; anti-MMP11 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTHREGDVHFDYDETWTIGDDQGTDLLQVAAHEFGHVLGLQHTTAAKALM
Sequence Length
488
Applicable Applications for anti-MMP11 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MMP11
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MMP11Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MMP11Sample Tissue: Human Mesenchymoma Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MMP11 antibody
Isoform PDE2A2: Regulates Mitochondrial cAMP Levels and Respiration.
Product Categories/Family for anti-MMP11 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
stromelysin-3 preproprotein
NCBI Official Synonym Full Names
matrix metallopeptidase 11
NCBI Official Symbol
MMP11
NCBI Official Synonym Symbols
ST3; SL-3; STMY3
NCBI Protein Information
stromelysin-3
UniProt Protein Name
Stromelysin-3
Protein Family
UniProt Gene Name
MMP11
UniProt Synonym Gene Names
STMY3; SL-3; ST3; MMP-11
UniProt Entry Name
MMP11_HUMAN

NCBI Description

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. However, the enzyme encoded by this gene is activated intracellularly by furin within the constitutive secretory pathway. Also in contrast to other MMP's, this enzyme cleaves alpha 1-proteinase inhibitor but weakly degrades structural proteins of the extracellular matrix. [provided by RefSeq, Jul 2008]

Uniprot Description

MMP11: May play an important role in the progression of epithelial malignancies. Belongs to the peptidase M10A family.

Protein type: Extracellular matrix; EC 3.4.24.-; Secreted, signal peptide; Protease; Secreted

Chromosomal Location of Human Ortholog: 22q11.23

Cellular Component: proteinaceous extracellular matrix; Golgi lumen; extracellular region

Molecular Function: zinc ion binding; metalloendopeptidase activity; calcium ion binding

Biological Process: extracellular matrix disassembly; collagen catabolic process; extracellular matrix organization and biogenesis; collagen fibril organization; multicellular organismal development; proteolysis; negative regulation of fat cell differentiation

Research Articles on MMP11

Similar Products

Product Notes

The MMP11 mmp11 (Catalog #AAA3221614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MMP11 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MMP11 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MMP11 mmp11 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTHREGDVHF DYDETWTIGD DQGTDLLQVA AHEFGHVLGL QHTTAAKALM. It is sometimes possible for the material contained within the vial of "MMP11, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.