Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MLN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Rabbit anti-Human, Sheep MLN Polyclonal Antibody | anti-MLN antibody

MLN antibody - middle region

Reactivity
Human, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MLN; Polyclonal Antibody; MLN antibody - middle region; anti-MLN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LQRMQEKERNKGQKKSLSVWQRSGEEGPVDPAEPIREEENEMIKLTAPLE
Sequence Length
115
Applicable Applications for anti-MLN antibody
Western Blot (WB)
Homology
Human: 100%; Sheep: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MLN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MLN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)

Western Blot (WB) (WB Suggested Anti-MLN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: HT1080 cell lysate)
Related Product Information for anti-MLN antibody
This is a rabbit polyclonal antibody against MLN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as mo
Product Categories/Family for anti-MLN antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
3kDa
NCBI Official Full Name
promotilin isoform 1 preproprotein
NCBI Official Synonym Full Names
motilin
NCBI Official Symbol
MLN
NCBI Protein Information
promotilin
UniProt Protein Name
Promotilin
Protein Family
UniProt Gene Name
MLN
UniProt Synonym Gene Names
MAP
UniProt Entry Name
MOTI_HUMAN

NCBI Description

This gene encodes a small peptide hormone that is secreted by cells of the small intestine to regulate gastrointestinal contractions and motility. Proteolytic processing of the secreted protein produces the mature peptide and a byproduct referred to as motilin-associated peptide (MAP). Three transcript variants encoding different preproprotein isoforms but the same mature peptide have been found for this gene. [provided by RefSeq, May 2010]

Uniprot Description

MLN: Plays an important role in the regulation of interdigestive gastrointestinal motility and indirectly causes rhythmic contraction of duodenal and colonic smooth muscle. Belongs to the motilin family.

Protein type: Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: extracellular region

Molecular Function: hormone activity; receptor binding

Biological Process: G-protein coupled receptor protein signaling pathway; cell-cell signaling

Research Articles on MLN

Similar Products

Product Notes

The MLN mln (Catalog #AAA3207590) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLN antibody - middle region reacts with Human, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's MLN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MLN mln for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LQRMQEKERN KGQKKSLSVW QRSGEEGPVD PAEPIREEEN EMIKLTAPLE. It is sometimes possible for the material contained within the vial of "MLN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.