Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-MLL4 Antibody Titration: 5ug/mlPositive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Rabbit MLL4 Polyclonal Antibody | anti-KMT2B antibody

MLL4 antibody - N-terminal region

Gene Names
KMT2B; HRX2; MLL2; MLL4; TRX2; WBP7; DYT28; MLL1B; WBP-7; CXXC10
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Protein A purified
Synonyms
MLL4; Polyclonal Antibody; MLL4 antibody - N-terminal region; anti-KMT2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WAGPRVQRGRGRGRGRGWGPSRGCVPEEESSDGESDEEEFQGFHSDEDVA
Sequence Length
582
Applicable Applications for anti-KMT2B antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Guinea Pig: 92%; Horse: 83%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 92%; Yeast: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MLL4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-MLL4 Antibody Titration: 5ug/mlPositive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)

Western Blot (WB) (WB Suggested Anti-MLL4 Antibody Titration: 5ug/mlPositive Control: HepG2 cell lysateKMT2B is strongly supported by BioGPS gene expression data to be expressed in Human HepG2 cells)
Related Product Information for anti-KMT2B antibody
This is a rabbit polyclonal antibody against MLL4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: MLL4 a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. MLL4 is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
histone-lysine N-methyltransferase 2B
NCBI Official Synonym Full Names
lysine methyltransferase 2B
NCBI Official Symbol
KMT2B
NCBI Official Synonym Symbols
HRX2; MLL2; MLL4; TRX2; WBP7; DYT28; MLL1B; WBP-7; CXXC10
NCBI Protein Information
histone-lysine N-methyltransferase 2B
UniProt Protein Name
Histone-lysine N-methyltransferase 2B
UniProt Gene Name
KMT2B
UniProt Synonym Gene Names
HRX2; KIAA0304; MLL2; MLL4; TRX2; WBP7; Lysine N-methyltransferase 2B; WBP-7
UniProt Entry Name
KMT2B_HUMAN

NCBI Description

This gene encodes a protein which contains multiple domains including a CXXC zinc finger, three PHD zinc fingers, two FY-rich domains, and a SET (suppressor of variegation, enhancer of zeste, and trithorax) domain. The SET domain is a conserved C-terminal domain that characterizes proteins of the MLL (mixed-lineage leukemia) family. This gene is ubiquitously expressed in adult tissues. It is also amplified in solid tumor cell lines, and may be involved in human cancer. Two alternatively spliced transcript variants encoding distinct isoforms have been reported for this gene, however, the full length nature of the shorter transcript is not known. [provided by RefSeq, Jul 2008]

Uniprot Description

MLL2: may be a transcriptional regulator. Contains 3 A.T hook DNA-binding domains. Two alternatively spliced isoforms have been described.

Protein type: Methyltransferase; EC 2.1.1.43; Transcription factor; Methyltransferase, protein lysine; DNA-binding

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: nucleoplasm; histone methyltransferase complex; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; histone lysine N-methyltransferase activity (H3-K4 specific); transcription factor activity

Biological Process: ovulation; establishment and/or maintenance of chromatin architecture; ovarian follicle development; transcription, DNA-dependent; chromatin-mediated maintenance of transcription; histone H3-K4 methylation; oocyte differentiation; regulation of histone H3-K4 methylation; gene silencing

Research Articles on KMT2B

Similar Products

Product Notes

The KMT2B kmt2b (Catalog #AAA3201675) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MLL4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's MLL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KMT2B kmt2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WAGPRVQRGR GRGRGRGWGP SRGCVPEEES SDGESDEEEF QGFHSDEDVA. It is sometimes possible for the material contained within the vial of "MLL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.