Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- MLH1 Picoband antibody, MBS177968, Western blottingAll lanes: Anti MLH1 (MBS177968) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD)

MLH1 Polyclonal Antibody | anti-MLH1 antibody

Anti-MLH1 Antibody

Gene Names
MLH1; FCC2; COCA2; HNPCC; hMLH1; HNPCC2
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
MLH1; Polyclonal Antibody; Anti-MLH1 Antibody; DNA mismatch repair protein Mlh1; COCA 2; COCA2; FCC 2; FCC2; hMLH 1; hMLH1; HNPCC 2; HNPCC; HNPCC2; MGC5172; MLH 1; MLH1_HUMAN; MutL homolog 1 (E. coli); MutL homolog 1; MutL homolog 1 colon cancer nonpolyposis type 2; colon cancer; nonpolyposis type 2 (E. coli); MutL protein homolog 1; MutL; E. coli; homolog of; 1; mutL homolog 1; anti-MLH1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
756
Applicable Applications for anti-MLH1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human MLH1 (722-756aa KALRSHILPPKHFTEDGNILQLANLPDLYKVFERC), different from the related mouse sequence by three amino acids, and from the related rat sequence by four amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- MLH1 Picoband antibody, MBS177968, Western blottingAll lanes: Anti MLH1 (MBS177968) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD)

Western Blot (WB) (Anti- MLH1 Picoband antibody, MBS177968, Western blottingAll lanes: Anti MLH1 (MBS177968) at 0.5ug/mlLane 1: Rat Lung Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: COLO320 Whole Cell Lysate at 40ugPredicted bind size: 84KDObserved bind size: 84KD)
Related Product Information for anti-MLH1 antibody
Description: Rabbit IgG polyclonal antibody for DNA mismatch repair protein Mlh1(MLH1) detection. Tested with WB in Human;Mouse;Rat.

Background: MutL homolog 1, colon cancer, nonpolyposis type 2 (E Coli) is a protein that in humans is encoded by the MLH1 gene located on Chromosome 3. This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E Coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.
References
1. Tawfik HM, El-Maqsoud NM, Hak BH, El-Sherbiny YM (2011). "Head and neck squamous cell carcinoma: mismatch repair immunohistochemistry and promoter hypermethylation of hMLH1 gene". Am J Otolaryngol 32 (6): 528-36. 2. "Entrez Gene: MLH1 mutL homolog 1, colon cancer, nonpolyposis type 2 (E Coli)".

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73,837 Da
NCBI Official Full Name
DNA mismatch repair protein Mlh1 isoform 1
NCBI Official Synonym Full Names
mutL homolog 1
NCBI Official Symbol
MLH1
NCBI Official Synonym Symbols
FCC2; COCA2; HNPCC; hMLH1; HNPCC2
NCBI Protein Information
DNA mismatch repair protein Mlh1
UniProt Protein Name
DNA mismatch repair protein Mlh1
Protein Family
UniProt Gene Name
MLH1
UniProt Synonym Gene Names
COCA2
UniProt Entry Name
MLH1_HUMAN

NCBI Description

This gene was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). It is a human homolog of the E. coli DNA mismatch repair gene mutL, consistent with the characteristic alterations in microsatellite sequences (RER+phenotype) found in HNPCC. Alternative splicing results in multiple transcript variants encoding distinct isoforms. Additional transcript variants have been described, but their full-length natures have not been determined.[provided by RefSeq, Nov 2009]

Uniprot Description

MLH1: a protein involved in the repair of mismatches in DNA. Binds PMS2 or MLH1 and MLH3. Part of the BRCA1-associated genome surveillance complex (BASC), which contains BRCA1, MSH2, MSH6, MLH1, ATM, BLM, PMS2 and the RAD50- MRE11-NBS1 protein complex. This association could be a dynamic process changing throughout the cell cycle and within subnuclear domains. Interacts with MBD4. Interacts with EXO1. Defects in MLH1 are the cause of hereditary non-polyposis colorectal cancer type 2; Turcot syndrome, an autosomal dominant disorder characterized by malignant tumors of the brain; Muir-Torre syndrome (MTS), a rare autosomal dominant disorder characterized by sebaceous neoplasms and visceral malignancy; lobular carcinoma in situ; endometrial cancer; and non-polyposis colorectal cancer.

Protein type: DNA repair, damage; Tumor suppressor

Chromosomal Location of Human Ortholog: 3p21.3

Cellular Component: chiasma; male germ cell nucleus; membrane; MutLalpha complex; nucleoplasm; nucleus; synaptonemal complex

Molecular Function: ATP binding; ATPase activity; chromatin binding; guanine/thymine mispair binding; MutSalpha complex binding; protein binding; single-stranded DNA binding

Biological Process: DNA damage response, signal transduction resulting in induction of apoptosis; double-strand break repair via nonhomologous end joining; female meiosis chromosome segregation; isotype switching; male meiosis chromosome segregation; meiotic metaphase I plate congression; mismatch repair; negative regulation of mitotic recombination; oogenesis; poly(A) tail shortening; resolution of meiotic joint molecules as recombinants; somatic hypermutation of immunoglobulin genes; spermatogenesis; spindle midzone assembly involved in meiosis; synapsis; telomere clustering

Disease: Colorectal Cancer, Hereditary Nonpolyposis, Type 2; Mismatch Repair Cancer Syndrome; Muir-torre Syndrome

Research Articles on MLH1

Similar Products

Product Notes

The MLH1 mlh1 (Catalog #AAA177968) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-MLH1 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MLH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the MLH1 mlh1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "MLH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.